PPIRE18813
Target Protein Information
| Protein_Name | Protein S100-B |
|---|---|
| Protein_Sequence | MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE |
| Organism_Source | Bos taurus |
| Functional_Classification | EF hand proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | S100B |
| UniProt_ID | P02638 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NDR62-87 |
|---|---|
| Peptide_Sequence | KRLRRSAHARKETEFLRLKRTRLGLE |
| Peptide_Length | 26 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3221.81 |
|---|---|
| Aliphatic_Index | 82.69231 |
| Aromaticity | 0.03846 |
| Average_Rotatable_Bonds | 4.50000 |
| Charge_at_pH_7 | 7.09331 |
| Isoelectric_Point | 12.39393 |
|---|---|
| Hydrogen_Bond_Acceptors | 44 |
| Hydrogen_Bond_Donors | 58 |
| Topological_Polar_Surface_Area | 1503.45000 |
| X_logP_energy | -14.79331 |
Interaction Information
| Affinity | KD=20 uM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | 1PSB |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of the Ca2+/S100B/NDR Kinase Peptide Complex: Insights into S100 Target Specificity and Activation of the Kinase |
| Release_Year | 2003 |
| PMID | 14661952 |
| DOI | 10.1021/bi035089a |