PPIRE18845
Target Protein Information
| Protein_Name | Glycophorin-A |
|---|---|
| Protein_Sequence | MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | glycoproteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | GYPA |
| UniProt_ID | P02724 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 1779 |
|---|---|
| Peptide_Sequence | NIDRIYDKNLLMIKEHILAI |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(N)=O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2425.91 |
|---|---|
| Aliphatic_Index | 161.00000 |
| Aromaticity | 0.05000 |
| Average_Rotatable_Bonds | 4.25000 |
| Charge_at_pH_7 | 0.09012 |
| Isoelectric_Point | 7.54151 |
|---|---|
| Hydrogen_Bond_Acceptors | 32 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 977.15000 |
| X_logP_energy | -4.24833 |
Interaction Information
| Affinity | KD=175 nM |
|---|---|
| Affinity_Assay | receptor-ligand assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Immunogenicity and protectivity of Plasmodium falciparum EBA-175 peptide and its analog is associated with alpha-helical region shortening and displacement |
| Release_Year | 2003 |
| PMID | 14669987 |
| DOI | 10.1515/BC.2003.160 |