PPIRE18848
Target Protein Information
| Protein_Name | Glycophorin-A |
|---|---|
| Protein_Sequence | MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ |
| Organism_Source | Homo sapiens |
| Functional_Classification | sialoglycoproteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | GYPA |
| UniProt_ID | P02724 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 1818 |
|---|---|
| Peptide_Sequence | NNNFNNIPSRYNLYDKKLDL |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2455.71 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.15000 |
| Average_Rotatable_Bonds | 4.05000 |
| Charge_at_pH_7 | 0.99658 |
| Isoelectric_Point | 9.12116 |
|---|---|
| Hydrogen_Bond_Acceptors | 35 |
| Hydrogen_Bond_Donors | 36 |
| Topological_Polar_Surface_Area | 1115.20000 |
| X_logP_energy | -11.84523 |
Interaction Information
| Affinity | KD=146 nM |
|---|---|
| Affinity_Assay | erythrocyte binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Orientating Peptide Residues and Increasing the Distance between Pockets to Enable Fitting into MHC-TCR Complex Determine Protection against Malaria |
| Release_Year | 2004 |
| PMID | 15157087 |
| DOI | 10.1021/bi049698+ |