PPIRE18876
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MKMKIPICFLIILVLLKCVLSYNLNNDLSKNNNFSLNTYVRKDDVEDDSKNEIVDNIQKMVDDFSDDIGFVKTSMREVLLDTEASLEEVSDHVVQNISKYSLTIEEKLNLFDGLLEEFIENNKGLISNLSKRQQKLKGDKIKKVCDLILKKLKKLENVNKLIKYKIILKYGNKDNKKEMIQTLKNEEGLSDDFKNNLSNYETEQNNDDIKEIELVNFISTNYDKFVVNLEDLNKELLKDLNMALS |
| Organism_Source | Plasmodium falciparum (isolate 3D7) |
| Functional_Classification | microneme proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | Q8IDR4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HABP 33374 |
|---|---|
| Peptide_Sequence | LISNLSKRQQKLKGDKIKKVY |
| Peptide_Length | 21 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(C)C)[C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2488.02 |
|---|---|
| Aliphatic_Index | 106.66667 |
| Aromaticity | 0.04762 |
| Average_Rotatable_Bonds | 4.47619 |
| Charge_at_pH_7 | 5.99581 |
| Isoelectric_Point | 11.11769 |
|---|---|
| Hydrogen_Bond_Acceptors | 36 |
| Hydrogen_Bond_Donors | 38 |
| Topological_Polar_Surface_Area | 1090.60000 |
| X_logP_energy | -9.53653 |
Interaction Information
| Affinity | KD=750 nM |
|---|---|
| Affinity_Assay | Radioligand binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Biological and structural characteristics of the binding peptides from the sporozoite proteins essential for cell traversal (SPECT)-1 and -2 |
| Release_Year | 2011 |
| PMID | 20933029 |
| DOI | 10.1016/j.peptides.2010.09.026 |