PPIRE19032
Target Protein Information
| Protein_Name | Lysozyme C |
|---|---|
| Protein_Sequence | MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL |
| Organism_Source | Gallus gallus |
| Functional_Classification | glycosidases |
| Cellular_Localization | Extracellular |
| Gene_Names | LYZ |
| UniProt_ID | P00698 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | X6-1 |
|---|---|
| Peptide_Sequence | SKTPGAAAEXXC |
| Peptide_Length | 12 |
| Peptide_SMILES | C[C@H](NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)NCC(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | X11=biotinylated lysine; X12=norleucine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1048.14 |
|---|---|
| Aliphatic_Index | 25.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.66667 |
| Charge_at_pH_7 | -0.06251 |
| Isoelectric_Point | 6.23183 |
|---|---|
| Hydrogen_Bond_Acceptors | 18 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 478.41000 |
| X_logP_energy | -8.51210 |
Interaction Information
| Affinity | KD=234 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Role of Structure in Antibody Cross-reactivity Between Peptides and Folded Proteins |
| Release_Year | 1998 |
| PMID | 9680484 |
| DOI | 10.1006/jmbi.1998.1907 |