PPIRE19033
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE |
| Organism_Source | Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) |
| Functional_Classification | Viral transcriptional activators |
| Cellular_Localization | Nucleus |
| Gene_Names | tat |
| UniProt_ID | P04608 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide I |
|---|---|
| Peptide_Sequence | RKKRRQRRR |
| Peptide_Length | 9 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1339.62 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 5.77778 |
| Charge_at_pH_7 | 7.99737 |
| Isoelectric_Point | 13.20310 |
|---|---|
| Hydrogen_Bond_Acceptors | 19 |
| Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 762.65000 |
| X_logP_energy | -9.62018 |
Interaction Information
| Affinity | KD=1 uM |
|---|---|
| Affinity_Assay | transient electric birefringence |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The bend in RNA created by the trans-activation response element bulge of human immunodeficiency virus is straightened by arginine and by Tat-derived peptide |
| Release_Year | 1995 |
| PMID | 7597079 |
| DOI | 10.1073/pnas.92.13.6052 |