PPIRE19069
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | WDCKKKNDRSNYVCIPDRRIQLCIVNLSIIKTYTKETMKDHFIEASKKESQLLLKKNDNKYNSKFCNDLKNSFLDYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGEISEHEIKNFRKKWWNEFREKLWEAMLSEHKNNINNCKNIPQEELQITQWIKEWHGEFLLERDNRSKLPKSKCKNNTLYEACEKECIDPCMKYRDWIIRSKFEWHTLSKEYETQKVSKENAENYLIKISENKNDAKV |
| Organism_Source | Plasmodium falciparum |
| Functional_Classification | erythrocyte binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | EBA175 |
| UniProt_ID | A0A159SL51 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pep1815 |
|---|---|
| Peptide_Sequence | YTNQNINISQERDLQKHGFH |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)O)[C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2442.63 |
|---|---|
| Aliphatic_Index | 58.50000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 4.15000 |
| Charge_at_pH_7 | 0.18088 |
| Isoelectric_Point | 7.70523 |
|---|---|
| Hydrogen_Bond_Acceptors | 36 |
| Hydrogen_Bond_Donors | 38 |
| Topological_Polar_Surface_Area | 1155.33000 |
| X_logP_energy | -13.97063 |
Interaction Information
| Affinity | KD=106 nM |
|---|---|
| Affinity_Assay | erythrocyte binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Evidence supporting the hypothesis that specifically modifying a malaria peptide to fit into HLA-DR1*03 molecules induces antibody production and protection |
| Release_Year | 2005 |
| PMID | 15694510 |
| DOI | 10.1016/j.vaccine.2004.08.052 |