PPIRE19172
Target Protein Information
| Protein_Name | Protein S100-A4 |
|---|---|
| Protein_Sequence | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
| Organism_Source | Homo sapiens |
| Functional_Classification | calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | S100A4 |
| UniProt_ID | P26447 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MIIA1893-1923 |
|---|---|
| Peptide_Sequence | RRKLQRELEDATETADAMNREVSSLKNKLRR |
| Peptide_Length | 31 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3715.21 |
|---|---|
| Aliphatic_Index | 69.35484 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.38710 |
| Charge_at_pH_7 | 3.00507 |
| Isoelectric_Point | 10.99059 |
|---|---|
| Hydrogen_Bond_Acceptors | 55 |
| Hydrogen_Bond_Donors | 66 |
| Topological_Polar_Surface_Area | 1819.77000 |
| X_logP_energy | -22.26678 |
Interaction Information
| Affinity | KD=0.34 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of Ca2+-Bound S100A4 and Its Interaction with Peptides Derived from Nonmuscle Myosin-IIA |
| Release_Year | 2008 |
| PMID | 18410126 |
| DOI | 10.1021/bi702537s |