PPIRE19210
Target Protein Information
| Protein_Name | L-lactate dehydrogenase |
|---|---|
| Protein_Sequence | MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA |
| Organism_Source | Plasmodium falciparum (isolate CDC / Honduras) |
| Functional_Classification | dehydrogenases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | None |
| UniProt_ID | Q27743 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LDH peptide-II |
|---|---|
| Peptide_Sequence | NTALEIVNLHASPYVAPAAA |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(N)=O)[C@@H](C)O)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)O)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2022.29 |
|---|---|
| Aliphatic_Index | 117.50000 |
| Aromaticity | 0.05000 |
| Average_Rotatable_Bonds | 2.90000 |
| Charge_at_pH_7 | -0.91018 |
| Isoelectric_Point | 5.36345 |
|---|---|
| Hydrogen_Bond_Acceptors | 28 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 811.49000 |
| X_logP_energy | -7.90560 |
Interaction Information
| Affinity | KD=3.2 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development of diagnostic reagents: Raising antibodies against synthetic peptides of PfHRP-2 and LDH using microsphere delivery |
| Release_Year | 2006 |
| PMID | 17113917 |
| DOI | 10.1016/j.imbio.2006.05.003 |