PPIRE19237
Target Protein Information
| Protein_Name | Protein E6 |
|---|---|
| Protein_Sequence | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
| Organism_Source | Human papillomavirus type 16 |
| Functional_Classification | Viral regulatory proteins host cell cycle modulators |
| Cellular_Localization | Nucleus |
| Gene_Names | E6 |
| UniProt_ID | P03126 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | E6apm |
|---|---|
| Peptide_Sequence | YLQELLGE |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 964.08 |
|---|---|
| Aliphatic_Index | 146.25000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -1.99932 |
| Isoelectric_Point | 3.61369 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 404.94000 |
| X_logP_energy | -1.49500 |
Interaction Information
| Affinity | IC50=74.3 uM |
|---|---|
| Affinity_Assay | in vitro association assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design and Characterization of Helical Peptides that Inhibit the E6 Protein of Papillomavirus |
| Release_Year | 2004 |
| PMID | 15182185 |
| DOI | 10.1021/bi049552a |