PPIRE19312
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MPGPWVAMIMLPQPKESFGGKPIGWLFWNTCKGPRRDCPHCCCPICSWHCQLCFLQKNLGINYGSGPRRRGTRGKGRRIRRTASGGDQRREADSQRSFTNMDQ |
| Organism_Source | Bovine immunodeficiency virus (strain R29) |
| Functional_Classification | Viral transcriptional activators |
| Cellular_Localization | Nucleus |
| Gene_Names | tat |
| UniProt_ID | P19564 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | L-22 |
|---|---|
| Peptide_Sequence | RVRTRKGRRIRI |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(=N)N)C(C)C)[C@@H](C)O)[C@@H](C)CC)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Main chain cyclization; R1<-->I12; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1566.92 |
|---|---|
| Aliphatic_Index | 89.16667 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.75000 |
| Charge_at_pH_7 | 6.99767 |
| Isoelectric_Point | 13.20105 |
|---|---|
| Hydrogen_Bond_Acceptors | 21 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 801.07000 |
| X_logP_energy | -8.79988 |
Interaction Information
| Affinity | KD=5 nM |
|---|---|
| Affinity_Assay | electrophoretic mobility shift assay |
| PDB_ID | 2KDQ |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Simultaneous recognition of HIV-1 TAR RNA bulge and loop sequences by cyclic peptide mimics of Tat protein |
| Release_Year | 2009 |
| PMID | 19584251 |
| DOI | 10.1073/pnas.0900629106 |