PPIRE19341
Target Protein Information
| Protein_Name | Somatostatin receptor type 5 |
|---|---|
| Protein_Sequence | MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | SSTR5 |
| UniProt_ID | P35346 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Octreotide |
|---|---|
| Peptide_Sequence | fCFwKTCT |
| Peptide_Length | 8 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@@H](N)Cc1ccccc1)[C@@H](C)O)C(=O)O |
| Chemical_Modification | f1=D-phenylalanine; w4=D-tryptophan; T8=Thr-ol |
| Cyclization_Method | Side chain-side chain cyclization; C2<-->C7; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Thr-ol |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1035.24 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.37500 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | 0.87374 |
| Isoelectric_Point | 8.22969 |
|---|---|
| Hydrogen_Bond_Acceptors | 14 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 349.29000 |
| X_logP_energy | -1.24850 |
Interaction Information
| Affinity | Ki=13 nM |
|---|---|
| Affinity_Assay | Radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide aromatic interactions modulated by fluorinated residues: Synthesis structure and biological activity of Somatostatin analogs containing 3-(3--5--difluorophenyl)-alanine |
| Release_Year | 2016 |
| PMID | 27271737 |
| DOI | 10.1038/srep27285 |