PPIRE19374
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 2A |
|---|---|
| Protein_Sequence | KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGLDLDDVCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFKVKWIFSSVVELKQTISPDYRNMIGQGA |
| Organism_Source | Mus musculus |
| Functional_Classification | monoclonal antibody |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg2a |
| UniProt_ID | P01865 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Phage15 |
|---|---|
| Peptide_Sequence | MVPLHDPHHFLKHSY |
| Peptide_Length | 15 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1858.15 |
|---|---|
| Aliphatic_Index | 71.33333 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | 0.36092 |
| Isoelectric_Point | 7.86972 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 671.64000 |
| X_logP_energy | -2.65060 |
Interaction Information
| Affinity | EC50=980 pM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Selection of Peptidic Mimics of Digoxin from Phage-displayed Peptide Libraries by Anti-digoxin Antibodies |
| Release_Year | 2000 |
| PMID | 10926495 |
| DOI | 10.1006/jmbi.2000.3934 |