PPIRE19475
Target Protein Information
| Protein_Name | Serine/threonine-protein phosphatase PP1-alpha catalytic subunit |
|---|---|
| Protein_Sequence | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK |
| Organism_Source | Homo sapiens |
| Functional_Classification | phosphatases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PPP1CA |
| UniProt_ID | P62136 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MCYST-RR |
|---|---|
| Peptide_Sequence | aRXeXRR |
| Peptide_Length | 7 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | X3=Adda; X5=Mdha |
| Cyclization_Method | Main chain-main chain cyclization; a1<-->R7; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 800.88 |
|---|---|
| Aliphatic_Index | 14.28571 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 1.99975 |
| Isoelectric_Point | 12.19913 |
|---|---|
| Hydrogen_Bond_Acceptors | 12 |
| Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 460.92000 |
| X_logP_energy | -6.75559 |
Interaction Information
| Affinity | IC50=11 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Co-occurrence of non-toxic (cyanopeptolin) and toxic (microcystin) peptides in a bloom of Microcystis sp. from a Chilean lake |
| Release_Year | 2000 |
| PMID | 10930070 |
| DOI | 10.1016/S0723-2020(00)80004-1 |