PPIPT02363
Target Protein Information
| Protein_Name | Somatostatin receptor type 2 |
|---|---|
| Protein_Sequence | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | SSTR2 |
| UniProt_ID | P30874 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | IMP466 |
|---|---|
| Peptide_Sequence | DFCFWKTCX |
| Peptide_Length | 9 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CS)C(=O)NCC(=O)O |
| Chemical_Modification | X8=threoninol |
| Cyclization_Method | Side chain-side chain cyclization; C3<-->C6; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1106.28 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.55556 |
| Charge_at_pH_7 | -0.12581 |
| Isoelectric_point | 6.06420 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 395.46000 |
| X_logP_energy | -2.03840 |
Interaction Information
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Methods and Compositions for Improved F-18 Labeling of Proteins, Peptides and Other Molecules |
| Release_Year | 2014 |
| Patent_ID | US20140377177A1 |