PPIPT02377
Target Protein Information
| Protein_Name | Interleukin-6 |
|---|---|
| Protein_Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Organism_Source | Homo sapiens |
| Functional_Classification | Cytokine (Interleukin family) |
| Cellular_Localization | Extracellular |
| Gene_Names | IL6 |
| UniProt_ID | P05231 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | UBITh1-EK-IL-652-72 |
|---|---|
| Peptide_Sequence | SSKEALAENNLNLPKMAEKDG |
| Peptide_Length | 21 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | None |
| C-terminal_Modification | None |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2259.52 |
|---|---|
| Aliphatic_Index | 70.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.80952 |
| Charge_at_pH_7 | -0.99713 |
| Isoelectric_point | 4.58762 |
|---|---|
| Hydrogen_Bond_Acceptors | 35 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 1033.52000 |
| X_logP_energy | -12.75010 |
Interaction Information
| Affinity | IC50=0.97 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Peptide immunogens targeting interleukin 6 (il-6) and formulations thereof for immunotherapy of diseases impacted by il-6 dysregulation |
| Release_Year | 2022 |
| Patent_ID | US20220105163A1 |