PPIPT02395
Target Protein Information
| Protein_Name | Mitotic spindle assembly checkpoint protein MAD2A |
|---|---|
| Protein_Sequence | MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND |
| Organism_Source | Homo sapiens |
| Functional_Classification | Mitotic checkpoint regulatory protein |
| Cellular_Localization | Nucleus |
| Gene_Names | MAD2L1 |
| UniProt_ID | Q13257 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Cdc20P1 |
|---|---|
| Peptide_Sequence | DSKGGRILRIKSGKPK |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1740.08 |
|---|---|
| Aliphatic_Index | 73.12500 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 4.99724 |
| Isoelectric_point | 11.82263 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 796.67000 |
| X_logP_energy | -9.28916 |
Interaction Information
| Affinity | KD=3.6 uM |
|---|---|
| Affinity_Assay | tryptophan fluorescence |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Class of 12mer peptides that inhibit the function of the mitotic check point protein Mad2 |
| Release_Year | 2003 |
| Patent_ID | US20030083261A1 |