PPIPT02437
Target Protein Information
| Protein_Name | Prolactin-releasing peptide receptor |
|---|---|
| Protein_Sequence | MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPHGQNMTVSVVI |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | PRLHR |
| UniProt_ID | P49683 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | IRPAGRF |
|---|---|
| Peptide_Sequence | IRPAGRF |
| Peptide_Length | 7 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 815.97 |
|---|---|
| Aliphatic_Index | 70.00000 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.42857 |
| Charge_at_pH_7 | 1.99798 |
| Isoelectric_point | 12.50011 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 352.93000 |
| X_logP_energy | -2.72006 |
Interaction Information
| Affinity | KD=10 uM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Therapeutic compositions and methods relating to prolactin releasing peptide (PrRP) |
| Release_Year | 2003 |
| Patent_ID | US20030171270A1 |