PPIPT02496
Target Protein Information
| Protein_Name | Serine/threonine-protein kinase Sgk1 |
|---|---|
| Protein_Sequence | MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL |
| Organism_Source | Homo sapiens |
| Functional_Classification | Serine/threonine protein kinase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SGK1 |
| UniProt_ID | O00141 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | YAAEIASAL |
|---|---|
| Peptide_Sequence | YAAEIASAL |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 908.02 |
|---|---|
| Aliphatic_Index | 131.11111 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -1.00109 |
| Isoelectric_point | 3.84998 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 373.88000 |
| X_logP_energy | -2.74610 |
Interaction Information
| Affinity | KD=20 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Novel peptides, combination of peptides as targets and for use in immunotherapy against gallbladder cancer and cholangiocarcinoma and other cancers |
| Release_Year | 2021 |
| Patent_ID | US20210380662A1 |