PPIPT02505
Target Protein Information
| Protein_Name | Solute carrier family 35 member E1 |
|---|---|
| Protein_Sequence | MAAAAVGAGHGAGGPGAASSSGGAREGARVAALCLLWYALSAGGNVVNKVILSAFPFPVTVSLCHILALCAGLPPLLRAWRVPPAPPVSGPGPSPHPSSGPLLPPRFYPRYVLPLAFGKYFASVSAHVSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQSTKVYLSLIPIISGVLLATVTELSFDMWGLVSALAATLCFSLQNIFSKKVLRDSRIHHLRLLNILGCHAVFFMIPTWVLVDLSAFLVSSDLTYVYQWPWTLLLLAVSGFCNFAQNVIAFSILNLVSPLSYSVANATKRIMVITVSLIMLRNPVTSTNVLGMMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNSYSLNRYDV |
| Organism_Source | Homo sapiens |
| Functional_Classification | Solute carrier (SLC35 family) |
| Cellular_Localization | Plasma membrane |
| Gene_Names | SLC35E1 |
| UniProt_ID | Q96K37 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SAFPFPVTVSL |
|---|---|
| Peptide_Sequence | SAFPFPVTVSL |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@@H](N)CO)C(C)C)[C@@H](C)O)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1164.37 |
|---|---|
| Aliphatic_Index | 97.27273 |
| Aromaticity | 0.18182 |
| Average_Rotatable_Bonds | 2.72727 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 397.43000 |
| X_logP_energy | -2.51250 |
Interaction Information
| Affinity | KD=10 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Novel peptides, combination of peptides as targets and for use in immunotherapy against gallbladder cancer and cholangiocarcinoma and other cancers |
| Release_Year | 2021 |
| Patent_ID | US20210380662A1 |