PPIST00302
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSPGIHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEENSS |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | DNDYIIPLPDPK |
| Peptide_Length | 12 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2PLE |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Nuclear magnetic resonance structure of an SH2 domain of phospholipase C-gamma 1 complexed with a high affinity binding peptide. |
|---|---|
| Release_Year | 1994 |
| PMID | 8181064 |
| DOI | 10.1016/0092-8674(94)90160-0 |