PPIST00323
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSRRASVGSHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQ |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XTYETLX |
| Peptide_Length | 7 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 1CSY |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the C-terminal SH2 domain of the human tyrosine kinase Syk complexed with a phosphotyrosine pentapeptide. |
|---|---|
| Release_Year | 1995 |
| PMID | 8590001 |
| DOI | 10.1016/S0969-2126(01)00242-8 |