PPIST17831
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | PLGSARCAVCEGPGELCDLFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHTFCLKPPMEELPAHSWKCKACRV |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | TGARTLADIKAKAQLVKAQ |
| Peptide_Length | 19 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 9ATN |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | ASXLs binding to the PHD2/3 fingers of MLL4 provides a mechanism for the recruitment of BAP1 to active enhancers. |
|---|---|
| Release_Year | 2024 |
| PMID | 38849395 |
| DOI | 10.1038/s41467-024-49391-x |