PPIDT00001
Drug Information
| Name | Lepirudin |
|---|---|
| Sequence | LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
| DrugBank_ID | DB00001 |
| Type | biotech |
| Indication | Lepirudin is indicated for anticoagulation in adult patients with acute coronary syndromes (ACS) such as unstable angina and acute myocardial infarction without ST elevation. In patients with ACS, lepirudin is intended for use with [aspirin].[L41539] Lepirudin is also indicated for anticoagulation in patients with heparin-induced thrombocytopenia (HIT) and associated thromboembolic disease in order to prevent further thromboembolic complications.[L41539] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, powder, for suspension | Intravenous |
50 mg
|
| Injection, solution, concentrate | Intravenous |
20 mg
|
| Injection, solution, concentrate | Intravenous |
50 mg
|
| Powder | Intravenous |
|
| Powder | Intravenous |
50 mg/1mL
|
| Powder, for solution | Intravenous |
50 mg / vial
|