PPIDT00012
Drug Information
| Name | Darbepoetin alfa |
|---|---|
| Sequence | MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCNETCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQVNETLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| DrugBank_ID | DB00012 |
| Type | biotech |
| Indication | For the treatment of anemia (from renal transplants or certain HIV treatment) |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, solution | Intravenous; Parenteral |
10 MCG
|
| Injection, solution | Intravenous; Parenteral |
100 MCG
|
| Injection, solution | Intravenous; Parenteral |
130 MCG
|
| Injection, solution | Intravenous; Parenteral |
15 MCG
|
| Injection, solution | Intravenous; Parenteral |
150 MCG
|
| Injection, solution | Intravenous; Parenteral |
20 MCG
|
| Injection, solution | Intravenous; Parenteral |
25 MCG
|
| Injection, solution | Intravenous; Parenteral |
30 MCG
|
| Injection, solution | Intravenous; Parenteral |
300 MCG
|
| Injection, solution | Intravenous; Parenteral |
40 MCG
|
| Injection, solution | Intravenous; Parenteral |
50 MCG
|
| Injection, solution | Intravenous; Parenteral |
500 MCG
|
| Injection, solution | Intravenous; Parenteral |
60 MCG
|
| Injection, solution | Intravenous; Parenteral |
80 MCG
|
| Injection, solution | Intravenous; Subcutaneous |
10 ug/0.4mL
|
| Injection, solution | Intravenous; Subcutaneous |
100 ug/0.5mL
|
| Injection, solution | Intravenous; Subcutaneous |
150 ug/0.3mL
|
| Injection, solution | Intravenous; Subcutaneous |
200 ug/0.4mL
|
| Injection, solution | Intravenous; Subcutaneous |
200 ug
|
| Injection, solution | Intravenous; Subcutaneous |
25 ug/0.42mL
|
| Injection, solution | Intravenous; Subcutaneous |
300 ug/0.6mL
|
| Injection, solution | Intravenous; Subcutaneous |
40 ug/.4mL
|
| Injection, solution | Intravenous; Subcutaneous |
40 ug/0.4mL
|
| Injection, solution | Intravenous; Subcutaneous |
500 ug/1mL
|
| Injection, solution | Intravenous; Subcutaneous |
60 ug/0.3mL
|
| Injection, solution | Parenteral; Subcutaneous |
10 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
100 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
15 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
150 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
20 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
30 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
300 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
40 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
50 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
500 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
60 MCG
|
| Injection, solution | Parenteral; Subcutaneous |
80 MCG
|
| Solution | Intravenous; Subcutaneous |
100 mcg / mL
|
| Solution | Intravenous; Subcutaneous |
100 ug/1mL
|
| Solution | Intravenous; Subcutaneous |
15 mcg / mL
|
| Solution | Intravenous; Subcutaneous |
150 ug/0.75mL
|
| Solution | Intravenous; Subcutaneous |
200 mcg / mL
|
| Solution | Intravenous; Subcutaneous |
200 ug/1mL
|
| Solution | Intravenous; Subcutaneous |
25 mcg / mL
|
| Solution | Intravenous; Subcutaneous |
25 ug/1mL
|
| Solution | Intravenous; Subcutaneous |
300 ug/1mL
|
| Solution | Intravenous; Subcutaneous |
325 mcg / mL
|
| Solution | Intravenous; Subcutaneous |
40 mcg / mL
|
| Solution | Intravenous; Subcutaneous |
40 ug/1mL
|
| Solution | Intravenous; Subcutaneous |
500 mcg / mL
|
| Solution | Intravenous; Subcutaneous |
60 ug/1mL
|
| Solution | Intravenous; Subcutaneous |
60 mcg / mL
|
| Solution | Parenteral |
10.000 mcg
|
| Injection | Intravenous; Subcutaneous |
10 mcg/0.4ml
|
| Injection, solution | Parenteral |
10 MIKROGRAMM
|
| Injection | Intravenous; Subcutaneous |
100 mcg/0.5ml
|
| Injection, solution | Parenteral |
100 MIKROGRAMM
|
| Injection, solution | Parenteral |
100 UG
|
| Injection, solution | Parenteral |
130 UG
|
| Injection | Intravenous; Subcutaneous |
150 mcg/0.3ml
|
| Injection, solution | Parenteral |
150 MIKROGRAMM
|
| Injection, solution | Parenteral |
150 UG
|
| Injection, solution | Parenteral |
15 UG
|
| Injection | Intravenous; Subcutaneous |
20 mcg/0.5ml
|
| Injection, solution | Parenteral |
20 MIKROGRAMM
|
| Injection, solution | Parenteral |
20 UG
|
| Injection | Intravenous; Subcutaneous |
30 mcg/0.3ml
|
| Injection, solution | Parenteral |
30 MIKROGRAMM
|
| Injection, solution | Parenteral |
300 MIKROGRAMM
|
| Injection, solution | Parenteral |
300 UG
|
| Injection, solution | Parenteral |
30 UG
|
| Injection | Intravenous; Subcutaneous |
40 mcg/0.4ml
|
| Injection, solution | Parenteral |
40 MIKROGRAMM
|
| Injection, solution | Parenteral |
40 UG
|
| Injection | Intravenous; Subcutaneous |
50 mcg/0.5ml
|
| Injection, solution | Parenteral |
50 MIKROGRAMM
|
| Injection, solution | Parenteral |
500 MIKROGRAMM
|
| Injection, solution | Parenteral |
500 UG
|
| Injection, solution | Parenteral |
50 UG
|
| Injection | Intravenous; Subcutaneous |
60 mcg/0.3ml
|
| Injection, solution | Parenteral |
60 MIKROGRAMM
|
| Injection, solution | Parenteral |
60 UG
|
| Injection | Intravenous; Subcutaneous |
80 mcg/0.4ml
|
| Injection, solution | Parenteral |
80 MIKROGRAMM
|
| Injection, solution | Parenteral |
80 UG
|
| Solution | Intravenous; Subcutaneous |
1000000 mcg
|
| Solution | Intravenous; Subcutaneous |
100 mcg
|
| Solution | Intravenous; Subcutaneous |
10000000 mcg
|
| Solution | Intravenous; Subcutaneous |
2000000 mcg
|
| Solution | Intravenous; Subcutaneous |
3000000 mcg
|
| Solution | Intravenous; Subcutaneous |
30000000 mcg
|
| Solution | Intravenous; Subcutaneous |
4000000 mcg
|
| Solution | Intravenous; Subcutaneous |
50 mcg
|
| Solution | Intravenous; Subcutaneous |
5000000 mcg
|
| Solution | Intravenous; Subcutaneous |
500 cg
|
| Solution | Intravenous; Subcutaneous |
6000000 mcg
|
| Solution | Intravenous; Subcutaneous |
8000000 mcg
|
| Solution | Intravenous; Subcutaneous |
15000000 mcg
|
| Injection | — |
120 mcg/0.5ml
|
| Injection | — |
20 mcg/0.5ml
|
| Injection | — |
30 mcg/0.5ml
|
| Injection | — |
40 mcg/0.5ml
|
| Injection | — |
60 mcg/0.5ml
|
| Injection, solution, concentrate | Intravenous; Subcutaneous |
10 mcg/0.5ml
|
| Injection, solution, concentrate | Intravenous; Subcutaneous |
120 mcg/0.5ml
|
| Solution | Intravenous; Subcutaneous |
120 mcg/0.5ml
|
| Injection, solution, concentrate | Intravenous; Subcutaneous |
180 mcg/0.5ml
|
| Solution | Intravenous; Subcutaneous |
180 mcg/0.5ml
|
| Injection, solution, concentrate | Intravenous; Subcutaneous |
20 mcg/0.5ml
|
| Solution | Intravenous; Subcutaneous |
20 mcg/0.5ml
|
| Injection, solution, concentrate | Intravenous; Subcutaneous |
30 mcg/0.5ml
|
| Solution | Intravenous; Subcutaneous |
30 mcg/0.5ml
|
| Injection, solution, concentrate | Intravenous; Subcutaneous |
40 mcg/0.5ml
|
| Solution | Intravenous; Subcutaneous |
40 mcg/0.5ml
|
| Injection, solution, concentrate | Intravenous; Subcutaneous |
60 mcg/0.5ml
|
| Solution | Intravenous; Subcutaneous |
60 mcg/0.5ml
|
| Injection | Intravenous |
|
| Injection, solution | Intravenous |
10 MCG
|
| Injection, solution | Intravenous |
100 MCG
|
| Injection, solution | Intravenous |
15 MCG
|
| Injection, solution | Intravenous |
150 MCG
|
| Injection, solution | Intravenous |
20 MCG
|
| Injection, solution | Intravenous |
25 MCG
|
| Injection, solution | Intravenous |
30 MCG
|
| Injection, solution | Intravenous |
300 MCG
|
| Injection, solution | Intravenous |
40 MCG
|
| Injection, solution | Intravenous |
50 MCG
|
| Injection, solution | Intravenous |
500 MCG
|
| Injection, solution | Intravenous |
60 MCG
|
| Injection, solution | Intravenous |
80 MCG
|
| Injection, solution | Intravenous; Subcutaneous |
10 ug
|
| Injection, solution | Intravenous; Subcutaneous |
100 ug
|
| Injection, solution | Intravenous; Subcutaneous |
130 ug
|
| Injection, solution | Intravenous; Subcutaneous |
15 ug
|
| Injection, solution | Intravenous; Subcutaneous |
150 ug
|
| Injection, solution | Intravenous; Subcutaneous |
20 ug
|
| Injection, solution | Intravenous; Subcutaneous |
25 ug
|
| Injection, solution | Intravenous; Subcutaneous |
30 ug
|
| Injection, solution | Intravenous; Subcutaneous |
300 ug
|
| Injection, solution | Intravenous; Subcutaneous |
40 ug
|
| Injection, solution | Intravenous; Subcutaneous |
50 ug
|
| Injection, solution | Intravenous; Subcutaneous |
500 ug
|
| Injection, solution | Intravenous; Subcutaneous |
60 ug
|
| Injection, solution | Intravenous; Subcutaneous |
80 ug
|
| Injection, solution | Subcutaneous |
10 ug
|
| Injection, solution | Subcutaneous |
10 MCG
|
| Injection, solution | Subcutaneous |
100 ug
|
| Injection, solution | Subcutaneous |
100 MCG
|
| Injection, solution | Subcutaneous |
130 ug
|
| Injection, solution | Subcutaneous |
15 MCG
|
| Injection, solution | Subcutaneous |
15 ug
|
| Injection, solution | Subcutaneous |
150 ug
|
| Injection, solution | Subcutaneous |
150 MCG
|
| Injection, solution | Subcutaneous |
20 MCG
|
| Injection, solution | Subcutaneous |
20 ug
|
| Injection, solution | Subcutaneous |
30 ug
|
| Injection, solution | Subcutaneous |
30 MCG
|
| Injection, solution | Subcutaneous |
300 MCG
|
| Injection, solution | Subcutaneous |
300 ug
|
| Injection, solution | Subcutaneous |
40 MCG
|
| Injection, solution | Subcutaneous |
40 ug
|
| Injection, solution | Subcutaneous |
50 MCG
|
| Injection, solution | Subcutaneous |
50 ug
|
| Injection, solution | Subcutaneous |
500 MCG
|
| Injection, solution | Subcutaneous |
500 ug
|
| Injection, solution | Subcutaneous |
60 ug
|
| Injection, solution | Subcutaneous |
60 MCG
|
| Injection, solution | Subcutaneous |
80 ug
|
| Injection, solution | Subcutaneous |
80 MCG
|