PPIDT00013
Drug Information
| Name | Urokinase |
|---|---|
| Sequence | KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL |
| DrugBank_ID | DB00013 |
| Type | biotech |
| Indication | In Canada, urokinase is indicated for lysis of acute massive pulmonary emboli, acute thrombi obstructing coronary arteries, occlusive thromboemboli in peripheral arteries and grafts, and restoration of patency to intravenous catheters.[L12141] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, powder, lyophilized, for solution | Intravenous |
250000 [iU]/5mL
|
| Powder, for solution | Intravenous |
250000 unit / vial
|
| Powder, for solution | Intravenous |
5000 unit / vial
|
| Solution | — |
|
| Injection, powder, lyophilized, for solution | Parenteral |
50000000000 IU
|
| Injection, powder, for solution | Intravenous |
100000 IU
|
| Injection, powder, for solution | Intravenous |
1000000 IU
|
| Injection, powder, for solution | Intravenous |
25000 IU
|
| Injection, powder, for solution | Intravenous |
250000 IU
|
| Injection, powder, for solution | Intravenous |
500000 IU
|
| Injection, powder, for solution | Intravenous bolus; Intravenous drip; Intravitreal |
100000 IU/2ML
|
| Injection, powder, for solution | Intravenous bolus; Intravenous drip; Intravitreal |
1000000 IU/5ML
|
| Injection, powder, for solution | Intravenous bolus; Intravenous drip; Intravitreal |
25000 IU/2ML
|
| Injection, powder, for solution | Intravenous bolus; Intravenous drip; Intravitreal |
500000 IU/5ML
|
| Injection, powder, for solution | Parenteral |
1000.000 U.I./5ML
|
| Injection, powder, for solution | Parenteral |
250000 U.I./5ML
|
| Injection, powder, for solution | Parenteral |
500000 U.I./5ML
|
| Injection, powder, for solution | — |
|
| Injection, powder, lyophilized, for solution | Intra-arterial; Intravenous |
250000 iu
|
| Injection, powder, lyophilized, for solution | Intra-arterial; Intravenous |
500000 iu
|
| Injection, powder, for solution | Parenteral |
|
| Injection, powder, for solution | Intravenous |
60000 iu
|
| Injection, powder, for solution | Parenteral |
1000.000 UI
|
| Powder, for solution | Intravenous |
500000 UI
|
| Powder | — |
60000 IU/1vial
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P00747 | PLG | Plasminogen | Homo sapiens | activator | Link |
| target | Q03405 | PLAUR | Urokinase plasminogen activator surface receptor | Homo sapiens | inducer|modulator | Link |
| target | P05121 | SERPINE1 | Plasminogen activator inhibitor 1 | Homo sapiens | substrate|inducer | Link |
| target | P05120 | SERPINB2 | Plasminogen activator inhibitor 2 | Homo sapiens | substrate|inducer | Link |
| target | P05154 | SERPINA5 | Plasma serine protease inhibitor | Homo sapiens | substrate | Link |
| target | P98164 | LRP2 | Low-density lipoprotein receptor-related protein 2 | Homo sapiens | substrate | Link |
| target | Q9Y5Y6 | ST14 | Suppressor of tumorigenicity 14 protein | Homo sapiens | substrate | Link |
| target | P14543 | NID1 | Nidogen-1 | Homo sapiens | ligand | Link |
| enzyme | P39900 | MMP12 | Macrophage metalloelastase | Homo sapiens | substrate | Link |