PPIDT00016
Drug Information
| Name | Erythropoietin |
|---|---|
| Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
| DrugBank_ID | DB00016 |
| Type | biotech |
| Indication | Indicated in adult and paediatric patients for the: - treatment of anemia due to Chronic Kidney Disease (CKD) in patients on dialysis and not on dialysis. - treatment of anemia due to zidovudine in patients with HIV-infection. - treatment of anemia due to the effects of concomitant myelosuppressive chemotherapy, and upon initiation, there is a minimum of two additional months of planned chemotherapy. - reduction of allogeneic RBC transfusions in patients undergoing elective, noncardiac, nonvascular surgery. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, solution | Intravenous |
1000 UI/0.5ML
|
| Injection, solution | Intravenous |
10000 UI/1.0ML
|
| Injection, solution | Intravenous |
3000 UI/0.3ML
|
| Injection, solution | Intravenous |
4000 UI/0.4ML
|
| Injection, solution | Intravenous |
5000 UI/0.5ML
|
| Injection, solution | Intravenous |
6000 UI/0.6ML
|
| Injection, solution | Intravenous |
8000 UI/0.8ML
|
| Solution | Intravenous |
1000 UI/0.5ML
|
| Solution | Intravenous |
2000 UI/1.0ML
|
| Solution | Intravenous |
3000 UI/0.3ML
|
| Injection, solution | Parenteral |
10000 I.E./1ML
|
| Injection, solution | Parenteral |
1000 I.E./0.5ML
|
| Injection, solution | Parenteral |
2000 I.E./1ML
|
| Injection, solution | Parenteral |
3000 I.E./0.3ML
|
| Injection, solution | Parenteral |
4000 I.E./0.4ML
|
| Injection, solution | Parenteral |
5000 I.E./0.5ML
|
| Injection, solution | Parenteral |
6000 I.E./0.6ML
|
| Injection, solution | Parenteral |
8000 I.E./0.8ML
|
| Injection, solution | — |
4000 IU/ml
|
| Injection, solution | Intravenous |
20000 UI/0.5ML
|
| Injection, solution | Intravenous |
30000 UI/0.75ML
|
| Injection, solution | Intravenous |
40000 UI/1.0ML
|
| Injection, solution | Intravenous; Subcutaneous |
2000 IU/1.0ML
|
| Injection, solution | Intravenous; Subcutaneous |
20000 IU/0.5ML
|
| Injection, solution | Intravenous; Subcutaneous |
3000 IU/3.0ML
|
| Injection, solution | Intravenous; Subcutaneous |
30000 IU/0.75ML
|
| Injection, solution | Intravenous; Subcutaneous |
40000 IU/1ML
|
| Injection, solution | Intravenous; Subcutaneous |
40000 IU/1.0ML
|
| Injection, solution | Subcutaneous |
7000 UI/0.7ML
|
| Injection, solution | Subcutaneous |
9000 UI/0.9ML
|
| Solution | Intravenous; Parenteral |
1000 UI/0.5ML
|
| Solution | Intravenous; Parenteral |
10000 UI/1ML
|
| Solution | Intravenous; Parenteral |
2000 UI/1ML
|
| Solution | Intravenous; Parenteral |
20000 UI/0.5ML
|
| Solution | Intravenous; Parenteral |
3000 UI/0.3ML
|
| Solution | Intravenous; Parenteral |
30000 UI/0.75ML
|
| Solution | Intravenous; Parenteral |
4000 UI/0.4ML
|
| Solution | Intravenous; Parenteral |
40000 UI/1ML
|
| Solution | Intravenous; Parenteral |
5000 UI/0.5ML
|
| Solution | Intravenous; Parenteral |
6000 UI/0.6ML
|
| Solution | Intravenous; Parenteral |
7000 UI/0.7ML
|
| Solution | Intravenous; Parenteral |
8000 UI/0.8ML
|
| Solution | Intravenous; Parenteral |
9000 UI/0.9ML
|
| Injection, solution | Parenteral |
10.000 I.E./1ML
|
| Injection, solution | Intravenous; Subcutaneous |
10000 iu/1ml
|
| Solution | Intravenous; Subcutaneous |
2000 IU/ml
|
| Injection, solution | Parenteral |
2.000 I.E./1.0ML
|
| Injection, solution | Parenteral |
2.000 I.E./1ML
|
| Injection, solution | Parenteral |
2.000 IE/1ML
|
| Injection, solution | Intravenous; Subcutaneous |
2000 iu/1ml
|
| Injection, solution | Parenteral |
2000 IE/1ML
|
| Injection, solution | Parenteral |
3.000 I.E./0.3ML
|
| Injection, solution | Parenteral |
3000 IE/0.3ML
|
| Injection, solution | Parenteral |
4.000 I.E./0.4ML
|
| Solution | Intravenous; Subcutaneous |
40000 IU/ml
|
| Injection, solution | Parenteral |
40.000 I.E./1ML
|
| Injection, solution | Parenteral |
40.000 IE/1ML
|
| Injection, solution | Parenteral |
40000 I.E./1ML
|
| Injection, solution | Parenteral |
5.000 I.E./0.5ML
|
| Injection, solution | Parenteral |
6.000 I.E./0.6ML
|
| Injection, solution | Parenteral |
8.000 I.E./0.8ML
|
| Injection, solution | Intravenous |
2000 iu/0.2ml
|
| Injection, solution | Intravenous |
3000 iu/0.3ml
|
| Injection, solution | Intravenous |
4000 iu/0.4ml
|
| Injection, solution | — |
10000 iu/1ml
|
| Solution | Intravenous; Subcutaneous |
10000 IU/ml
|
| Solution | Intravenous; Subcutaneous |
2000 IU/0.6ml
|
| Injection, solution | — |
3333 iu/1ml
|
| Injection, solution | — |
40000 iu/1ml
|
| Solution | Intravenous; Subcutaneous |
4000 IU/0.4ml
|
| Injection | Intravenous |
10000 iu/1.0ml
|
| Injection | Intravenous |
1000 iu/0.3ml
|
| Injection | Intravenous |
2000 iu/0.6ml
|
| Injection | Intravenous |
3000 iu/0.9ml
|
| Injection | Intravenous |
4000 iu/0.4ml
|
| Injection | Intravenous |
5000 iu/0.5ml
|
| Injection | Intravenous |
6000 iu/0.6ml
|
| Injection | Intravenous |
8000 iu/0.8ml
|
| Injection | — |
10000 IU/ml
|
| Injection, solution | Parenteral |
10000 IE
|
| Injection, solution | Parenteral |
1000 IE
|
| Injection, solution | Parenteral |
20000 IE
|
| Injection, solution | Parenteral |
2000 IE
|
| Injection, solution | Parenteral |
30000 IE
|
| Injection, solution | Parenteral |
3000 IE
|
| Injection, solution | Parenteral |
40000 IE
|
| Injection, solution | Parenteral |
4000 IE
|
| Injection, solution | Parenteral |
5000 IE
|
| Injection, solution | Parenteral |
6000 IE
|
| Injection, solution | Parenteral |
8000 IE
|
| Solution | Intravenous; Subcutaneous |
10000 [iU]/1mL
|
| Solution | Intravenous; Subcutaneous |
2000 [iU]/1mL
|
| Solution | Intravenous; Subcutaneous |
20000 [iU]/1mL
|
| Solution | Intravenous; Subcutaneous |
3000 [iU]/1mL
|
| Solution | Intravenous; Subcutaneous |
4000 [iU]/1mL
|
| Solution | Intravenous; Subcutaneous |
40000 1/1mL
|
| Injection | — |
6000 IU/ml
|
| Injection, solution | Intravenous |
2000 iu/ml
|
| Injection, solution | Intravenous |
4000 iu/ml
|
| Injection, solution | Intravenous; Parenteral |
10000 UI/1.0ML
|
| Injection, solution | Intravenous; Parenteral |
20000 UI/1.0ML
|
| Injection, solution | Intravenous; Parenteral |
30000 UI/1.0ML
|
| Injection, solution | Intravenous; Subcutaneous |
10000 IU/1.0ML
|
| Injection, solution | Intravenous; Subcutaneous |
2000 IU/0.5ML
|
| Injection, solution | Intravenous; Subcutaneous |
20000 IU/1.0ML
|
| Injection, solution | Intravenous; Subcutaneous |
3000 IU/0.5ML
|
| Injection, solution | Intravenous; Subcutaneous |
30000 IU/1.0ML
|
| Injection, solution | Intravenous; Subcutaneous |
4000 IU/0.5ML
|
| Injection, solution | Intravenous; Subcutaneous |
5000 IU/0.5ML
|
| Solution | Subcutaneous |
8.300 mcg
|
| Injection, solution | Parenteral |
1000 IE/0.5ML
|
| Injection, solution | Parenteral |
1.0 ML
|
| Injection, solution | Parenteral |
10000 IE/1.0ML
|
| Injection, solution | Parenteral |
2000 IE/0.5ML
|
| Injection, solution | Parenteral |
1 ML
|
| Injection, solution | Parenteral |
20000 IE/1.0ML
|
| Injection, solution | Parenteral |
20000 IE/1ML
|
| Injection, solution | Parenteral |
30.000 IE/1.0ML
|
| Injection, solution | Parenteral |
3000 IE/0.5ML
|
| Injection, solution | Parenteral |
30000 IE/1.0ML
|
| Injection, solution | Parenteral |
30000 IE/1ML
|
| Injection, solution | Parenteral |
4000 IE/0.5ML
|
| Injection, solution | Parenteral |
0.5 ML
|
| Injection | Intravenous; Subcutaneous |
10000 iu/1.0ml
|
| Solution | — |
4000 iu/0.4ml
|
| Injection | — |
10000 IU
|
| Injection | — |
4000 IU
|
| Solution | Parenteral |
4000 UI
|
| Injection, solution | — |
|
| Injection, solution | Intravenous; Subcutaneous |
|
| Injection, powder, lyophilized, for solution | Intravenous; Subcutaneous |
100000000 IU
|
| Injection, solution | — |
30000 UI/0.75ML
|
| Injection, solution | — |
40000 UI
|
| Injection, solution | — |
40000 UI/ML
|
| Injection, solution | Intravenous; Subcutaneous |
1000 IU/0.5ml
|
| Injection, solution | Intravenous; Subcutaneous |
10000 IU/ml
|
| Injection, solution | Intravenous; Subcutaneous |
2000 IU/ml
|
| Injection, solution | Intravenous; Subcutaneous |
3000 IU/0.3ml
|
| Injection, solution | Intravenous; Subcutaneous |
4000 IU/0.4ml
|
| Injection, solution | Intravenous; Subcutaneous |
4000 IU/ml
|
| Injection, solution | Intravenous; Subcutaneous |
500 IU/0.25ml
|
| Injection, solution | Intravenous; Subcutaneous |
6000 IU/0.6ml
|
| Injection, solution | Intravenous; Subcutaneous |
7000 IU/0.7ml
|
| Injection, solution | Intravenous; Subcutaneous |
8000 IU/0.8ml
|
| Injection, solution | Intravenous; Subcutaneous |
9000 IU/0.9ml
|
| Injection, solution | Parenteral |
40000 IU/ML
|
| Solution | — |
2000 iu/0.5ml
|
| Solution | — |
40000 IU/1ml
|
| Injection | Subcutaneous |
10000 iu/ml
|
| Injection | — |
2000 IU/0.5ml
|
| Injection | Subcutaneous |
2000 iu/0.5ml
|
| Injection | Intravenous; Subcutaneous |
3000 iu/0.3ml
|
| Injection | — |
4000 IU/0.4ml
|
| Injection | Subcutaneous |
4000 iu/0.4ml
|
| Injection | — |
40000 IU/ml
|
| Injection | Intravenous; Subcutaneous |
40000 iu/ml
|
| Injection | Intravenous; Subcutaneous |
6000 iu/0.6ml
|
| Injection | Intravenous; Subcutaneous |
10000 IU/ML
|
| Injection | Intravenous; Subcutaneous |
2000 IU/0.5ml
|
| Injection | Intravenous; Subcutaneous |
4000 IU/0.4ml
|
| Solution | Intravenous; Subcutaneous |
20000 unit / 0.5 mL
|
| Solution | Intravenous; Subcutaneous |
30000 unit / 0.75 mL
|
| Solution | Intravenous; Subcutaneous |
10000 unit / mL
|
| Solution | Intravenous; Subcutaneous |
1000 unit / 0.5 mL
|
| Solution | Intravenous; Subcutaneous |
20000 unit / mL
|
| Solution | Intravenous; Subcutaneous |
2000 unit / 0.5 mL
|
| Solution | Intravenous; Subcutaneous |
2000 unit / mL
|
| Solution | Intravenous; Subcutaneous |
3000 unit / 0.3 mL
|
| Solution | Intravenous; Subcutaneous |
40000 unit / mL
|
| Solution | Intravenous; Subcutaneous |
4000 unit / 0.4 mL
|
| Solution | Intravenous; Subcutaneous |
4000 unit / mL
|
| Solution | Intravenous; Subcutaneous |
5000 unit / 0.5 mL
|
| Solution | Intravenous; Subcutaneous |
6000 unit / 0.6 mL
|
| Solution | Intravenous; Subcutaneous |
8000 unit / 0.8 mL
|
| Solution | Intravenous; Subcutaneous |
1000000000 IU
|
| Solution | Intravenous; Subcutaneous |
2000 IU
|
| Solution | Intravenous; Subcutaneous |
4000000000 IU
|
| Injection, powder, lyophilized, for solution | Intravenous; Subcutaneous |
200000000 IU
|
| Injection, powder, lyophilized, for solution | Intravenous; Subcutaneous |
400000000 IU
|
| Solution | Intravenous; Subcutaneous |
400000000 IU
|
| Solution | Parenteral |
200000000 IU
|
| Solution | Intravenous; Subcutaneous |
200000000 IU
|
| Solution | Parenteral |
1000 UI
|
| Injection | — |
2 IU/ML
|
| Injection | — |
4 IU/ML
|
| Injection | Parenteral |
|
| Injection, solution | Parenteral |
1000 IU
|
| Injection, solution | Parenteral |
10000 IU
|
| Injection, solution | Parenteral |
2000 IU
|
| Injection, solution | Parenteral |
20000 I.E./0.5ML
|
| Injection, solution | Parenteral |
3000 IU
|
| Injection, solution | Parenteral |
30000 I.E./0.75ML
|
| Injection, solution | Parenteral |
4000 IU
|
| Injection, solution | Parenteral |
40000 I.E./ML
|
| Injection, solution | Parenteral |
5000 IU
|
| Injection, solution | Parenteral |
6000 IU
|
| Injection, solution | Parenteral |
8000 IU
|
| Injection | Intravenous |
|
| Injection | Intravenous |
2000 IU/0.5ml
|
| Solution | — |
4000 iu/1ml
|
| Solution | Parenteral |
2000 UI
|
| Injection, solution | — |
1000 IU/0.25ml
|
| Injection | — |
3000 IU
|
| Injection, powder, for solution | — |
1000 IU
|
| Injection, powder, for solution | — |
10000 IU
|
| Injection, powder, for solution | — |
2000 IU
|
| Injection, powder, for solution | — |
3000 IU
|
| Injection, powder, for solution | Intravenous; Subcutaneous |
50000 IU
|
| Injection, solution | Intravenous; Parenteral |
1000 IU/0.3ML
|
| Injection, solution | Intravenous; Parenteral |
10000 IU/0.6ML
|
| Injection, solution | Intravenous; Parenteral |
10000 IU
|
| Injection, solution | Intravenous; Parenteral |
2000 IU/0.3ML
|
| Injection, solution | Intravenous; Parenteral |
20000 IU/0.6ML
|
| Injection, solution | Intravenous; Parenteral |
3000 IU/0.3ML
|
| Injection, solution | Intravenous; Parenteral |
4000 IU/0.3ML
|
| Injection, solution | Intravenous; Parenteral |
500 IU/0.3ML
|
| Injection, solution | Intravenous; Parenteral |
5000 IU/0.3ML
|
| Injection, solution | Intravenous; Parenteral |
6000 IU/0.3ML
|
| Injection, solution | Intravenous; Parenteral; Subcutaneous |
2000 IU/0.3ML
|
| Injection, solution | Intravenous; Subcutaneous |
10000 IU
|
| Injection, solution | Intravenous; Subcutaneous |
2000 IU
|
| Injection, solution | Intravenous; Subcutaneous |
20000 IU
|
| Injection, solution | Intravenous; Subcutaneous |
3000 IU
|
| Injection, solution | Intravenous; Subcutaneous |
30000 IU
|
| Injection, solution | Intravenous; Subcutaneous |
4000 IU
|
| Injection, solution | Intravenous; Subcutaneous |
500 IU
|
| Injection, solution | Intravenous; Subcutaneous |
5000 IU
|
| Injection, solution | Intravenous; Subcutaneous |
6000 IU
|
| Injection, solution | Parenteral; Subcutaneous |
4000 IU
|
| Injection, solution | Parenteral; Subcutaneous |
6000 IU
|
| Powder | Intravenous |
1000 UI
|
| Powder | Intravenous |
10000 UI
|
| Powder | Intravenous |
2000 UI
|
| Powder | Intravenous |
500 UI
|
| Powder | Intravenous |
5000 UI
|
| Powder | Parenteral |
100000 IU/ml
|
| Powder | Parenteral |
50000 IU/ml
|
| Powder | Subcutaneous |
10000 UI
|
| Powder | Subcutaneous |
20000 UI
|
| Injection, solution | Parenteral |
10.000 I.E.
|
| Injection, solution | Intravenous; Subcutaneous |
10000 iu/0.6ml
|
| Injection, solution | Parenteral |
10000 IU/0.6ml
|
| Injection, solution | Intravenous; Subcutaneous |
2000 iu/0.3ml
|
| Injection, solution | Intravenous; Subcutaneous |
20000 iu/0.6ml
|
| Injection, solution | Parenteral |
2000 IU/0.3ml
|
| Injection, solution | Parenteral |
3000 IU/0.3ml
|
| Injection, solution | Parenteral |
4000 IU/0.3ml
|
| Injection, solution | Parenteral |
5000 IU/0.3ml
|
| Injection, solution | Intravenous; Subcutaneous |
5000 iu/0.3ml
|
| Injection, solution | Parenteral |
500 IU/0.3ml
|
| Injection, solution | Parenteral |
6000 IU/0.3ml
|
| Injection, solution | Intravenous; Subcutaneous |
10000 [iU]/1mL
|
| Injection, solution | Intravenous; Subcutaneous |
2000 [iU]/1mL
|
| Injection, solution | Intravenous; Subcutaneous |
20000 [iU]/1mL
|
| Injection, solution | Intravenous; Subcutaneous |
3000 [iU]/1mL
|
| Injection, solution | Intravenous; Subcutaneous |
4000 [iU]/1mL
|
| Injection, solution | Intravenous; Subcutaneous |
40000 [iU]/1mL
|
| Injection | — |
2000 IU
|
| Injection | — |
5000 IU
|
| Injection, solution | — |
2000 IU/0.3ml
|
| Injection, solution | — |
3000 IU/0.3ml
|
| Injection, solution | — |
5000 IU/0.3ml
|
| Injection | — |
30000 IU
|
| Injection | Intravenous; Subcutaneous |
10000 iu/0.6ml
|
| Injection | Intravenous; Subcutaneous |
2000 iu/0.3ml
|
| Injection | Intravenous; Subcutaneous |
|
| Injection, solution | Intravenous; Subcutaneous |
30000 IU/0.6ml
|
| Injection | Intravenous; Subcutaneous |
4000 iu/0.3ml
|
| Injection | Intravenous; Subcutaneous |
5000 iu/0.3ml
|
| Solution | Parenteral |
1000 IU
|
| Solution | Intravenous; Subcutaneous |
500 IU
|
| Solution | Intravenous; Subcutaneous |
5000 IU
|
| Solution | — |
3000 IU/0.3ml
|
| Solution | Intravenous; Subcutaneous |
30000 IU
|
| Injection | — |
|
| Injection | — |
12000 IU/0.5ml
|
| Injection | — |
2000 IU/ml
|
| Injection | — |
3000 IU/ml
|
| Injection | — |
4000 IU/ml
|
| Injection, solution | Intravenous; Parenteral |
1000 UI/0.3ML
|
| Injection, solution | Intravenous; Parenteral |
10000 IU/1.0ML
|
| Injection, solution | Intravenous; Parenteral |
2000 IU/0.6ML
|
| Injection, solution | Intravenous; Parenteral |
2000 UI/0.6ML
|
| Injection, solution | Intravenous; Parenteral |
20000 IU/0.5ML
|
| Injection, solution | Intravenous; Parenteral |
20000 UI/0.5ML
|
| Injection, solution | Intravenous; Parenteral |
3000 UI/0.9ML
|
| Injection, solution | Intravenous; Parenteral |
3000 IU/0.9ML
|
| Injection, solution | Intravenous; Parenteral |
30000 IU/0.75ML
|
| Injection, solution | Intravenous; Parenteral |
30000 UI/0.75ML
|
| Injection, solution | Intravenous; Parenteral |
4000 IU/0.4ML
|
| Injection, solution | Intravenous; Parenteral |
4000 UI/0.4ML
|
| Injection, solution | Intravenous; Parenteral |
40000 IU/1.0ML
|
| Injection, solution | Intravenous; Parenteral |
40000 UI/1.0ML
|
| Injection, solution | Intravenous; Parenteral |
5000 IU/0.5ML
|
| Injection, solution | Intravenous; Parenteral |
5000 UI/0.5ML
|
| Injection, solution | Intravenous; Parenteral |
6000 IU/0.6ML
|
| Injection, solution | Intravenous; Parenteral |
6000 UI/0.6ML
|
| Injection, solution | Intravenous; Parenteral |
8000 IU/0.8ML
|
| Injection, solution | Intravenous; Parenteral |
8000 UI/0.8ML
|
| Injection, solution | Intravenous; Subcutaneous |
1000 IU/0.3ML
|
| Injection, solution | Intravenous; Subcutaneous |
2000 IU/0.6ML
|
| Injection, solution | Intravenous; Subcutaneous |
3000 IU/0.9ML
|
| Injection, solution | Parenteral |
10.000 I.E./1.0ML
|
| Injection, solution | Parenteral |
10000 I.E./1.0ML
|
| Injection, solution | Parenteral |
1000 I.E./0.3ML
|
| Injection, solution | Parenteral |
1000 IE/0.3ML
|
| Injection, solution | Parenteral |
2.000 I.E./0.6ML
|
| Injection, solution | Parenteral |
2000 I.E./0.6ML
|
| Injection, solution | Parenteral |
20000 IE/0.5ML
|
| Injection, solution | Parenteral |
2000 IE/0.6ML
|
| Injection, solution | Parenteral |
3.000 I.E./0.9ML
|
| Injection, solution | Parenteral |
30.000 IE/0.75ML
|
| Injection, solution | Parenteral |
3000 I.E./0.9ML
|
| Injection, solution | Parenteral |
30000 IE/0.75ML
|
| Injection, solution | Parenteral |
3000 IE/0.9ML
|
| Injection, solution | Parenteral |
4.000 IE/0.4ML
|
| Injection, solution | Parenteral |
40.000 I.E./1.0ML
|
| Injection, solution | Parenteral |
40000 I.E./1.0ML
|
| Injection, solution | Parenteral |
40000 IE/1.0ML
|
| Injection, solution | Parenteral |
4000 IE/0.4ML
|
| Injection, solution | Parenteral |
5000 IE/0.5ML
|
| Injection, solution | Parenteral |
6.000 IE/0.6ML
|
| Injection, solution | Parenteral |
6000 IE/0.6ML
|
| Injection, solution | Parenteral |
8000 IE/0.8ML
|
| Injection, solution | — |
4000 IU/1ml
|
| Solution | — |
10000 IU/0.6ml
|
| Solution | — |
2000 IU/0.3ml
|
| Solution | — |
30000 IU/0.6ml
|
| Solution | — |
5000 IU/0.3ml
|
| Injection, solution | — |
2000 iu/0.5ml
|
| Solution | — |
10000 iu/1ml
|
| Solution | — |
2000 iu/1ml
|
| Injection, solution | — |
4000 iu/0.4ml
|
| Injection, solution | — |
5000 IU/0.5ml
|
| Injection, powder, for solution | — |
4000 IU
|