PPIDT00017
Drug Information
| Name | Salmon calcitonin |
|---|---|
| Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP |
| DrugBank_ID | DB00017 |
| Type | biotech |
| Indication | Used in the treatment of symptomatic Paget's disease for patients unresponsive to alternate treatments or intolerant to such treatments. In addition, it is used in emergency situations when serum calcium levels must be decreased quickly until the underlying condition is identified. It can also be added to existing therapeutic regimens for hypercalcemia such as intravenous fluids and furosemide, oral phosphate or corticosteroids, or other agents. Calcitonin can be used in patients with azotemia and cases where intravenous fluids would be contraindicated due to limited cardiac reserves. Also for the treatment of post-menopausal osteoporosis in women more than 5 years post-menopause. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Liquid | Intramuscular; Subcutaneous |
200 unit / mL
|
| Solution | Nasal |
200 unit / spray
|
| Solution | Intramuscular; Subcutaneous |
200 unit / mL
|
| Injection, solution | Parenteral |
100 I.E./ml
|
| Injection, solution | Parenteral |
50 I.E./ml
|
| Injection, solution | — |
|
| Injection, solution | Intramuscular; Subcutaneous |
200 [iU]/1mL
|
| Powder | Not applicable |
1 g/1g
|
| Spray, metered | Nasal |
200 [iU]/0.09mL
|
| Spray | Nasal |
|
| Injection, solution | Intramuscular; Intravenous; Subcutaneous |
100 IU/ML
|
| Injection, solution | Intramuscular; Intravenous; Subcutaneous |
50 IU/ML
|
| Spray | Nasal |
100 U.I.
|
| Spray | Nasal |
50 U.I.
|
| Solution | — |
100 IU/1ml
|
| Solution | — |
50 IU/1ml
|
| Liquid | Intramuscular; Subcutaneous |
100 unit / mL
|
| Injection, solution | Intramuscular; Intravenous; Subcutaneous |
100 IU
|
| Spray, metered | Nasal |
2200 [iU]/1mL
|
| Spray | Nasal |
200 IU
|
| Spray | Nasal |
2200 IU
|
| Injection, solution | — |
100 IU/1ml
|
| Injection, solution | — |
50 IU/1ml
|
| Injection, solution | Intramuscular; Subcutaneous |
100 iu
|
| Injection | Intramuscular; Subcutaneous |
100 IU/ml
|
| Injection | Intramuscular; Subcutaneous |
50 IU/ml
|
| Injection | Intramuscular; Intravenous; Subcutaneous |
100 iu/ml
|
| Injection | Intramuscular; Intravenous; Subcutaneous |
50 iu/ml
|
| Spray | Nasal |
200 iu/dose
|
| Spray, metered | Nasal |
200 IU
|
| Injection, solution | Intramuscular |
200 [iU]/1mL
|
| Injection, solution | Intramuscular; Subcutaneous |
200 [USP'U]/1mL
|
| Injection, solution | Intramuscular; Subcutaneous |
200.0 [iU]/1.0mL
|
| Spray, metered | Nasal |
200 [iU]/1
|
| Liquid | Intramuscular; Intravenous; Subcutaneous |
200 unit / mL
|
| Spray | Nasal |
200 unit / act
|
| Spray | Nasal |
200 IU/1dose
|
| Liquid | Nasal |
200 unit / spray
|
| Spray | Nasal |
100 IU
|
| Solution; spray | Nasal |
200 IU/1dose
|