PPIDT00020
Drug Information
| Name | Sargramostim |
|---|---|
| Sequence | APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
| DrugBank_ID | DB00020 |
| Type | biotech |
| Indication | For the treatment of cancer and bone marrow transplant |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, powder, for solution | Intravenous; Subcutaneous |
250 ug/1mL
|
| Injection, powder, for solution | Subcutaneous |
250 ug/1mL
|
| Injection, powder, lyophilized, for solution | Intravenous; Subcutaneous |
250 ug/1mL
|
| Injection, solution | Intravenous; Subcutaneous |
500 ug/1mL
|
| Liquid | Intravenous; Subcutaneous |
500 ug/1mL
|
| Liquid | Subcutaneous |
500 ug/1mL
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P15509 | CSF2RA | Granulocyte-macrophage colony-stimulating factor receptor subunit alpha | Homo sapiens | agonist | Link |
| target | P26951 | IL3RA | Interleukin-3 receptor subunit alpha | Homo sapiens | agonist | Link |
| target | P32927 | CSF2RB | Cytokine receptor common subunit beta | Homo sapiens | agonist | Link |
| target | P34741 | SDC2 | Syndecan-2 | Homo sapiens | agonist | Link |
| target | P13727 | PRG2 | Bone marrow proteoglycan | Homo sapiens | unknown | Link |