PPIDT00030
Drug Information
| Name | Menotropins |
|---|---|
| Sequence | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| DrugBank_ID | DB00032 |
| Type | biotech |
| Indication | For the treatment of female infertility |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, powder, lyophilized, for solution | Intramuscular |
150 IU
|
| Injection, powder, lyophilized, for solution | Intramuscular |
75 IU
|
| Injection | Intramuscular; Subcutaneous |
150 IU
|
| Injection, powder, for solution | — |
|
| Injection, powder, for solution | Intramuscular |
75 IU/ampoule
|
| Injection, powder, for solution | Intramuscular; Subcutaneous |
7500000 IU
|
| Powder, for solution | Subcutaneous |
75 unit / vial
|
| Injection, powder, for solution | Parenteral |
1200 I.E.
|
| Injection, powder, for solution | Parenteral |
600 I.E.
|
| Injection, powder, for solution | Subcutaneous |
|
| Injection, powder, for solution | Intramuscular; Subcutaneous |
1200 IU
|
| Injection, powder, for solution | Intramuscular; Subcutaneous |
600 IU
|
| Injection, powder, for solution | Intramuscular; Subcutaneous |
75 IU
|
| Injection | Intramuscular |
75 IU
|
| Injection, powder, for solution | Intramuscular; Subcutaneous |
150 IU
|
| Injection, powder, for solution | Parenteral |
900 UI
|
| Injection, powder, for solution | Parenteral |
150 I.E.
|
| Injection, solution | Parenteral |
150 iu
|
| Injection, powder, for solution | Parenteral |
75 I.E.
|
| Injection, powder, for solution | Parenteral |
900 I.E.
|
| Injection, powder, for solution | — |
1200 UI
|
| Injection, powder, for solution | — |
600 UI
|
| Injection, powder, for solution | Parenteral |
75 IU
|
| Injection, solution | Parenteral |
1200 I.U.
|
| Injection, solution | Parenteral |
600 I.U.
|
| Injection, solution | Parenteral |
75 IU
|
| Powder, for solution | Intramuscular; Subcutaneous |
75 unit / vial
|
| Injection, powder, for solution | Parenteral |
5000 I.E.
|
| Injection, powder, for solution | — |
1200 IU
|
| Injection, powder, for solution | — |
600 IU
|
| Powder | — |
75 IU
|
| Powder | — |
150 IU
|