PPIDT00036
Drug Information
| Name | Palifermin |
|---|---|
| Sequence | MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| DrugBank_ID | DB00039 |
| Type | biotech |
| Indication | For treatment of oral mucositis associated with chemotherapy and radiation therapy. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection | Intravenous |
6.25 mg/1mL
|
| Injection, powder, for solution | Intravenous |
|
| Injection, powder, lyophilized, for solution | Intravenous |
5.16 mg/1.2mL
|
| Injection, powder, lyophilized, for solution | Intravenous |
6.25 mg/1.2mL
|
| Powder, for solution | Intravenous |
6.25 mg / vial
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P21802 | FGFR2 | Fibroblast growth factor receptor 2 | Homo sapiens | agonist|binder | Link |
| target | P11362 | FGFR1 | Fibroblast growth factor receptor 1 | Homo sapiens | agonist | Link |
| target | P98160 | HSPG2 | Basement membrane-specific heparan sulfate proteoglycan core protein | Homo sapiens | ligand | Link |