PPIDT00051
Drug Information
| Name | Alpha-1-proteinase inhibitor |
|---|---|
| Sequence | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
| DrugBank_ID | DB00058 |
| Type | biotech |
| Indication | For chronic augmentation and maintenance therapy in individuals with alpha1-proteinase inhibitor (A1-PI) deficiency and clinical evidence of emphysema. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Powder, for solution | Intravenous |
1 g / vial
|
| Powder, for solution | Intravenous |
500 mg / vial
|
| Injection, powder, lyophilized, for solution; kit | Intravenous |
16 mg/1mL
|
| Kit | Intravenous |
16 mg/1mL
|
| Injection, solution | Intravenous |
1 g/50mL
|
| Solution | Intravenous |
1000 mg / 50 mL
|
| Injection, powder, for solution | Parenteral |
1000 mg
|
| Injection, powder, for solution | Parenteral |
4000 mg
|
| Injection, powder, for solution | Parenteral |
5000 mg
|
| Injection | Intravenous |
1000 mg
|
| Powder, for solution | Intravenous |
25 mg / mL
|
| Injection, powder, lyophilized, for solution; kit | Intravenous |
|
| Injection; kit | Intravenous |
1000 mg/20mL
|
| Powder, for solution | Intravenous |
1000 mg / vial
|
| Injection, solution | Intravenous |
1000 mg/20mL
|
| Solution | Intravenous |
1000 mg / 20 mL
|
| Injection, powder, lyophilized, for solution | Intravenous |
100000000 mg
|
| Injection, powder, for solution | Intravenous |
1000 mg
|
| Injection, powder, for solution | Intravenous |
4000 mg
|
| Injection, powder, for solution | Intravenous |
5000 mg
|
| Powder, for solution | Intravenous |
1000 MG
|
| Injection, powder, lyophilized, for solution; kit | Intravenous |
1000 mg/20mL
|
| Injection, powder, lyophilized, for solution; kit | Intravenous |
4000 mg/76mL
|
| Injection, powder, lyophilized, for solution; kit | Intravenous |
5000 mg/95mL
|
| Kit; powder, for solution | Intravenous |
1000 mg / vial
|
| Kit; powder, for solution | Intravenous |
4000 mg / vial
|
| Kit; powder, for solution | Intravenous |
5000 mg / vial
|
| Injection, powder, for solution | Intravenous |
100000000 mg
|