PPIDT00064
Drug Information
| Name | Muromonab |
|---|---|
| Sequence | QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAHFRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC |
| DrugBank_ID | DB00075 |
| Type | biotech |
| Indication | For treatment of organ transplant recipients, prevention of organ rejection |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, solution | Intravenous |
5 mg/5mL
|
| Solution | Intravenous |
1 mg / mL
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P04234 | CD3D | T-cell surface glycoprotein CD3 delta chain | Homo sapiens | unknown | Link |
| target | P07766 | CD3E | T-cell surface glycoprotein CD3 epsilon chain | Homo sapiens | binder | Link |
| target | P09693 | CD3G | T-cell surface glycoprotein CD3 gamma chain | Homo sapiens | unknown | Link |
| target | P20963 | CD247 | T-cell surface glycoprotein CD3 zeta chain | Homo sapiens | unknown | Link |
| target | O75015 | FCGR3B | Low affinity immunoglobulin gamma Fc region receptor III-B | Homo sapiens | unknown | Link |