PPIDT00072
Drug Information
| Name | Alemtuzumab |
|---|---|
| Sequence | QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTTEYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| DrugBank_ID | DB00087 |
| Type | biotech |
| Indication | LEMTRADA is indicated for the treatment of relapsing forms of multiple sclerosis (MS), including relapsing-remitting disease and active secondary progressive disease, in adults. Because of its safety profile, the use of LEMTRADA should generally be reserved for patients who have had an inadequate response to two or more drugs indicated for the treatment of MS.[L43397] LEMTRADA contains the same active ingredient (alemtuzumab) found in CAMPATH, and CAMPATH is approved for the treatment of B-cell chronic lymphocytic leukemia (B-CLL), although generally administered at higher and more frequent doses (e.g., 30 mg) than recommended in the treatment of MS.[L43397] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection | Intravenous |
30 mg/1mL
|
| Injection, solution, concentrate | Intravenous |
12 mg/1.2mL
|
| Injection, solution, concentrate | Intravenous; Parenteral |
12 MG
|
| Solution | Intravenous |
12 mg / 1.2 mL
|
| Solution | Subcutaneous |
12.0000 mg
|
| Injection, solution, concentrate | — |
12 mg/1.2ml
|
| Injection, solution, concentrate | Intravenous |
12 mg
|
| Solution | Intravenous |
12 mg/1.2ml
|
| Solution | Intravenous |
1200000 mg
|
| Injection, solution, concentrate | Intravenous |
10 MG/ML
|
| Solution | Intravenous |
10 mg / mL
|
| Solution | Intravenous |
30 mg / mL
|
| Solution, concentrate | Intravenous |
30 MG/ML
|
| Solution | Intravenous |
3000000 mg
|
| Solution | Intravenous |
30 mg/ml
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P31358 | CD52 | CAMPATH-1 antigen | Homo sapiens | antibody | Link |
| target | O75015 | FCGR3B | Low affinity immunoglobulin gamma Fc region receptor III-B | Homo sapiens | binder | Link |
| target | P08637 | FCGR3A | Low affinity immunoglobulin gamma Fc region receptor III-A | Homo sapiens | binder | Link |
| target | P12314 | FCGR1A | High affinity immunoglobulin gamma Fc receptor I | Homo sapiens | binder | Link |
| target | P12318 | FCGR2A | Low affinity immunoglobulin gamma Fc region receptor II-a | Homo sapiens | binder | Link |
| target | P31994 | FCGR2B | Low affinity immunoglobulin gamma Fc region receptor II-b | Homo sapiens | binder | Link |
| target | P31995 | FCGR2C | Low affinity immunoglobulin gamma Fc region receptor II-c | Homo sapiens | binder | Link |