PPIDT00088
Drug Information
| Name | Enfuvirtide |
|---|---|
| Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| DrugBank_ID | DB00109 |
| Type | biotech |
| Indication | Enfuvirtide is an antiretroviral drug used in combination therapy for the treatment of HIV-1/AIDS. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, powder, for solution | Parenteral; Subcutaneous |
90 MG/ML
|
| Injection, powder, for solution | Subcutaneous |
90 mg/ml
|
| Injection, powder, lyophilized, for solution; kit | Subcutaneous |
90 mg/1mL
|
| Kit | Subcutaneous |
|
| Powder, for solution | Subcutaneous |
108 mg / vial
|
| Solution | Subcutaneous |
90.000 mg
|
| Injection, powder, lyophilized, for solution | Subcutaneous |
90 mg
|
| Injection, powder, lyophilized, for solution | Subcutaneous |
9000000 mg
|
| Solution | Subcutaneous |
108.00 mg
|
Target Information