PPIDT00106
Drug Information
| Name | Mecasermin |
|---|---|
| Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| DrugBank_ID | DB01277 |
| Type | biotech |
| Indication | For the long-term treatment of growth failure in pediatric patients with Primary IGFD or with GH gene deletion who have developed neutralizing antibodies to GH [A2322]. It is not indicated to treat Secondary IGFD resulting from GH deficiency, malnutrition, hypothyroidism or other causes; it is not a substitute for GH therapy. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Patch | Topical |
|
| Injection, solution | Parenteral; Subcutaneous |
10 MG/ML
|
| Injection, solution | Subcutaneous |
10 mg/ml
|
| Injection, solution | Subcutaneous |
40 mg/4mL
|
| Solution | Subcutaneous |
40 mg / 4 mL
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P08069 | IGF1R | Insulin-like growth factor 1 receptor | Homo sapiens | agonist | Link |
| target | P17936 | IGFBP3 | Insulin-like growth factor-binding protein 3 | Homo sapiens | unknown | Link |
| target | P06213 | INSR | Insulin receptor | Homo sapiens | unknown | Link |
| target | P11717 | IGF2R | Cation-independent mannose-6-phosphate receptor | Homo sapiens | unknown | Link |
| carrier | P17936 | IGFBP3 | Insulin-like growth factor-binding protein 3 | Homo sapiens | carrier | Link |
| carrier | P35858 | IGFALS | Insulin-like growth factor-binding protein complex acid labile subunit | Homo sapiens | carrier | Link |
| carrier | P08833 | IGFBP1 | Insulin-like growth factor-binding protein 1 | Homo sapiens | carrier | Link |
| carrier | P18065 | IGFBP2 | Insulin-like growth factor-binding protein 2 | Homo sapiens | carrier | Link |
| carrier | P22692 | IGFBP4 | Insulin-like growth factor-binding protein 4 | Homo sapiens | carrier | Link |
| carrier | P24593 | IGFBP5 | Insulin-like growth factor-binding protein 5 | Homo sapiens | carrier | Link |
| carrier | P24592 | IGFBP6 | Insulin-like growth factor-binding protein 6 | Homo sapiens | carrier | Link |