PPIDT00111
Drug Information
| Name | Corticotropin |
|---|---|
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF |
| DrugBank_ID | DB01285 |
| Type | biotech |
| Indication | For use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency. Purified corticotropin for injection is indicated for a variety of allergic and autoimmune conditions.[L39150] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection | Subcutaneous |
40 [USP'U]/0.5mL
|
| Injection | Subcutaneous |
80 [USP'U]/1mL
|
| Gel | Intramuscular; Subcutaneous |
40 unit / mL
|
| Powder, for solution | Intramuscular; Intravenous; Subcutaneous |
40 unit / vial
|
| Injection | Intramuscular; Subcutaneous |
80 [USP'U]/1mL
|
| Injection | Intravenous |
80 [iU]/1mL
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | Q01718 | MC2R | Adrenocorticotropic hormone receptor | Homo sapiens | agonist | Link |
| target | P06850 | CRH | Corticoliberin | Homo sapiens | agonist | Link |
| enzyme | P26439 | HSD3B2 | 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 | Homo sapiens | inducer | Link |
| enzyme | O15528 | CYP27B1 | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial | Homo sapiens | inducer | Link |
| enzyme | Q07973 | CYP24A1 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial | Homo sapiens | inducer | Link |
| enzyme | P08684 | CYP3A4 | Cytochrome P450 3A4 | Homo sapiens | substrate|inducer | Link |