PPIDT00119
Drug Information
| Name | Nesiritide |
|---|---|
| Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| DrugBank_ID | DB04899 |
| Type | biotech |
| Indication | For the intravenous treatment of patients with acutely decompensated congestive heart failure who have dyspnea at rest or with minimal activity. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, powder, lyophilized, for solution | Intravenous |
1.5 mg/5mL
|
| Powder, for solution | Intravenous |
1.5 mg / vial
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P16066 | NPR1 | Atrial natriuretic peptide receptor 1 | Homo sapiens | binder | Link |
| target | P20594 | NPR2 | Atrial natriuretic peptide receptor 2 | Homo sapiens | unknown | Link |
| target | P17342 | NPR3 | Atrial natriuretic peptide receptor 3 | Homo sapiens | unknown | Link |