PPIDT00163
Drug Information
| Name | Ustekinumab |
|---|---|
| Sequence | EVQLVQSGAEVKKPGESLKISCKGSGYSFTTYWLGWVRQMPGKGLDWIGIMSPVDSDIRYSPSFQGQVTMSVDKSITTAYLQWNSLKASDTAMYYCARRRPGQGYFDFWGQGTLVTVSSSSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH |
| DrugBank_ID | DB05679 |
| Type | biotech |
| Indication | Ustekinumab is indicated for the management of moderate to severe plaque psoriasis in patients 6 years of age and older who are candidates for phototherapy or systemic therapy.[L9386] In adult patients, it is also indicated for the management of active psoriatic arthritis (PsA) alone or in combination with methotrexate, moderately to severely active Crohn’s disease (CD) and moderately to severely active ulcerative colitis.[L45484] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Solution | Subcutaneous |
90 mg / 1 mL
|
| Injection | Subcutaneous |
45 mg/0.5ml
|
| Injection | Subcutaneous |
90 MG/ML
|
| Injection, solution | Intravenous; Subcutaneous |
45 MG
|
| Injection, solution | Intravenous; Subcutaneous |
90 MG
|
| Injection, solution | Subcutaneous |
45 mg/0.5mL
|
| Injection, solution | Subcutaneous |
90 mg/1mL
|
| Injection, solution, concentrate | Intravenous |
130 mg
|
| Injection, solution, concentrate | Intravenous; Parenteral |
130 MG
|
| Solution | Intravenous |
130 mg/26mL
|
| Solution | Subcutaneous |
45 mg / 0.5 mL
|
| Solution | Subcutaneous |
45.000 mg
|
| Solution | Subcutaneous |
90 mg / 1.0 mL
|
| Injection, solution, concentrate | Intravenous |
130 mg/26ml
|
| Injection, solution, concentrate | — |
130 mg/26ml
|
| Injection, solution | — |
45 mg
|
| Solution | — |
45 mg/0.5mL
|
| Injection, solution | — |
90 mg
|
| Injection, solution | Subcutaneous |
90 mg/mL
|
| Solution | Intravenous |
130 mg
|
| Solution | Intravenous |
5 mg / mL
|
| Solution | Intravenous |
135.000 mg
|
| Injection, solution | Subcutaneous |
45 mg
|
| Injection, solution | Subcutaneous |
90 mg
|
| Solution | Subcutaneous |
4500000 mg
|
| Solution | Subcutaneous |
9000000 mg
|
| Injection, solution | Intravenous |
130 mg/26mL
|
| Injection, solution | — |
90 mg/1ml
|