PPIDT00188
Drug Information
| Name | Ipilimumab |
|---|---|
| Sequence | QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| DrugBank_ID | DB06186 |
| Type | biotech |
| Indication | Ipilimumab is indicated in the following cancerous conditions:[L42050] **Melanoma** - Treatment of unresectable or metastatic melanoma in patients ≥12 years old - Treatment of unresectable or metastatic melanoma, in combination with [nivolumab], in adult patients - Adjuvant treatment of patients with cutaneous melanoma with pathologic involvement of regional lymph nodes of >1 mm who have undergone complete resection, including total lymphadenectomy **Renal Cell Carcinoma (RCC)** - First-line treatment of patients with intermediate- or poor-risk advanced renal cell carcinoma in combination with nivolumab **Colorectal Cancer** - In combination with nivolumab, treatment of patients ≥12 years old with microsatellite instability-high (MSI-H) or mismatch repair deficient (dMMR) metastatic colorectal cancer that has progressed following previous treatment with a fluoropyrimidine, [oxaliplatin], and [irinotecan] **Hepatocellular Carcinoma** - In combination with nivolumab, treatment of patients with hepatocellular carcinoma who have been previously treated with sorafenib **Non-Small Cell Lung Cancer (NSCLC)** - Treatment of adult patients with metastatic non-small cell lung cancer expressing PD-L1, with no EFGR or ALK genomic tumor aberrations, as first-line treatment in combination with nivolumab - Treatment of adult patients with metastatic or recurrent non-small cell lung cancer, with no EGFR or ALK genomic tumor aberrations, as first-line treatment in combination with nivolumab and 2 cycles of platinum-doublet chemotherapy **Malignant Pleural Mesothelioma** - Treatment of adult patients with unresectable malignant pleural mesothelioma, as first-line treatment in combination with nivolumab **Esophageal Cancer** - Treatment of adult patients with unresectable advanced or metastatic esophageal squamous cell carcinoma, as first line treatment in combination with nivolumab |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection | Intravenous |
5 mg/1mL
|
| Injection, solution, concentrate | Intravenous; Parenteral |
5 MG/ML
|
| Solution | Intravenous |
5 mg / mL
|
| Injection, solution, concentrate | Intravenous |
200 mg/40mL
|
| Injection, solution, concentrate | Intravenous |
5 mg/ml
|
| Injection, solution, concentrate | Intravenous |
50 mg/10mL
|
| Injection, solution, concentrate | Intravenous drip |
5 mg/ml
|
| Solution | Intravenous |
50 mg
|
| Solution | Intravenous |
5000000 mg
|
| Solution | Intravenous |
5 mg/1ml
|