Welcome To PPIKB

Drug Information

Name	Teriparatide
Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
DrugBank_ID	DB06285
Type	biotech
Indication	Teriparatide is indicated: - for the treatment of postmenopausal women with osteoporosis at high risk for fracture (defined herein as having a history of osteoporotic fracture or multiple risk factors for fracture) or who have failed or are intolerant to other available osteoporosis therapy. In postmenopausal women with osteoporosis, teriparatide reduces the risk of vertebral and nonvertebral fractures.[L42590, L42595, L46178, L46183] - to increase bone mass in men with primary or hypogonadal osteoporosis at high risk for fracture or who have failed or are intolerant to other available osteoporosis therapy.[L42590, L42595, L46178, L46183] - for the treatment of men and women with osteoporosis associated with sustained systemic glucocorticoid therapy (daily dosage equivalent to 5 mg or greater of prednisone) at high risk for fracture or who have failed or are intolerant to other available osteoporosis therapy.[L42590, L42595, L46178, L46183]

Target Information

Role	Uniprot_ID	Gene_Name	Entity_Name	Organism	Actions	Internal link
target	P01270	PTH	Parathyroid hormone	Homo sapiens	modulator	Link
target	Q03431	PTH1R	Parathyroid hormone/parathyroid hormone-related peptide receptor	Homo sapiens	ligand	Link