PPIDT00240
Drug Information
| Name | Tesamorelin |
|---|---|
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| DrugBank_ID | DB08869 |
| Type | biotech |
| Indication | Tesamorelin acetate is a synthetic analogue of human hypothalamic Growth Hormone Releasing Factor (hGRF) indicated to induce and maintain a reduction of excess abdominal fat in HIV-infected patients with lipodystrophy. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Kit | Subcutaneous |
|
| Kit | Subcutaneous |
1 mg/1mL
|
| Kit | Subcutaneous |
2 mg/2mL
|
| Kit; powder, for solution | Subcutaneous |
1 mg / vial
|
| Kit; powder, for solution | Subcutaneous |
2 mg / vial
|
| Solution | Subcutaneous |
2.000 mg
|
| Kit | Subcutaneous |
2 mg/0.5mL
|