PPIDT00242
Drug Information
| Name | Belimumab |
|---|---|
| Sequence | SSELTQDPAVSVALGQTVRVTCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCSSRDSSGNHWVFGGGTELTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS |
| DrugBank_ID | DB08879 |
| Type | biotech |
| Indication | In the US, belimumab is indicated to treat active systemic lupus erythematosus (SLE) and active lupus nephritis in patients aged five years and older who are receiving standard therapy.[L42630] In Europe, belimumab is also used to treat SLE and lupus nephritis but only in adults.[L42705] The efficacy of belimumab has not been evaluated in patients with severe active central nervous system lupus. Use of belimumab is not recommended in this situation.[L42630] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, powder, for solution | Intravenous |
120 MG
|
| Injection, powder, for solution | Intravenous |
400 MG
|
| Injection, powder, lyophilized, for solution | Intravenous |
120 mg/1.5mL
|
| Injection, powder, lyophilized, for solution | Intravenous |
400 mg/5mL
|
| Injection, solution | Parenteral; Subcutaneous |
200 MG
|
| Injection, solution | Subcutaneous |
200 mg
|
| Powder, for solution | Intravenous |
120 mg / vial
|
| Powder, for solution | Intravenous |
400 mg / vial
|
| Solution | Subcutaneous |
200 mg / 1 mL
|
| Solution | Subcutaneous |
200 mg/1mL
|
| Injection, solution | Intravenous |
120 mg
|
| Injection, powder, lyophilized, for solution | Intravenous |
12000000 mg
|
| Solution | Subcutaneous |
20000000 mg
|
| Injection | Intravenous |
400 mg
|
| Injection, powder, lyophilized, for solution | Intracavernous |
400 mg
|
| Injection, powder, lyophilized, for solution | Intravenous |
40000000 mg
|
| Injection, powder, lyophilized, for solution | Intravenous |
120 mg
|
| Injection, powder, lyophilized, for solution | Intravenous |
400 mg
|
| Suspension | Subcutaneous |
20000000 mg
|
| Solution | Intravenous |
120.000 mg
|
| Solution | Subcutaneous |
200 mg
|