PPIDT00243
Drug Information
| Name | Aflibercept |
|---|---|
| Sequence | SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG |
| DrugBank_ID | DB08885 |
| Type | biotech |
| Indication | The opthalmic agent is used for the treatment of neovascular (Wet) age-related macular degeneration (AMD), macular edema following retinal vein occlusion (RVO), diabetic macular edema (DME), diabetic retinopathy (DR), and retinopathy of prematurity (ROP).[L45136] The systemic injection, known as ziv-aflibercept, in combination with 5-fluorouracil, leucovorin, irinotecan-(FOLFIRI), is for the treatment of metastatic colorectal cancer that is resistant to or progressed following treatment with oxaliplatin.[L45141] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection | Intravitreal |
|
| Injection | Intravitreal |
40 MG/ML
|
| Injection, solution | Intravitreal |
114.3 mg/ml
|
| Injection, solution | Intravitreal |
40 MG/ML
|
| Injection, solution | Intravitreal |
40 mg/1mL
|
| Solution | Intravitreal |
2 mg / 0.05 mL
|
| Injection, solution | Intravitreal |
8 mg/0.07mL
|
| Solution | Intravitreal |
8 mg / 0.07 mL
|
| Injection, solution | Intravitreal |
2.0 mg/50mcl
|
| Solution | Intraocular |
200000 mg
|
| Injection, solution | Intravitreal |
2 mg/0.05mL
|
| Solution | Intraocular |
11.120 mg
|
| Injection | Intravenous |
25 MG/ML
|
| Injection, solution, concentrate | Intravenous |
25 mg/1ml
|
| Injection, solution, concentrate | Intravenous |
25 mg/ml
|
| Injection, solution, concentrate | Intravenous; Parenteral |
25 MG/ML
|
| Solution | Intravenous |
100 mg / 4 mL
|
| Solution | Intravenous |
200 mg / 8 mL
|
| Solution, concentrate | Intravenous |
100 mg/4mL
|
| Solution, concentrate | Intravenous |
200 mg/8mL
|
| Injection | Parenteral |
100 mg/4ml
|
| Injection | Parenteral |
|
| Injection, solution, concentrate | Intravenous |
200 mg/8ml
|
| Injection, solution, concentrate | Intravenous |
|
| Solution | Intravenous |
25.0 mg/ml
|
| Solution | Intravenous |
25.000 mg
|
| Solution | Ophthalmic |
40 mg/1ml
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P15692 | VEGFA | Vascular endothelial growth factor A, long form | Homo sapiens | inhibitor|binder | Link |
| target | P49763 | PGF | Placenta growth factor | Homo sapiens | inhibitor|binder | Link |
| target | P49765 | VEGFB | Vascular endothelial growth factor B | Homo sapiens | inhibitor|binder | Link |