PPIDT00272
Drug Information
| Name | Chorionic Gonadotropin (Human) |
|---|---|
| Sequence | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS |
| DrugBank_ID | DB09126 |
| Type | biotech |
| Indication | For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Liquid; powder, for solution | Intramuscular |
|
| Liquid | Intramuscular |
1000 unit / mL
|
| Powder | Parenteral |
1500 IU/1
|
| Powder | Parenteral |
5000 IU/1
|
| Solution | Parenteral |
1500 UI
|
| Injection, solution | Intramuscular |
5000 iu
|
| Solution | Parenteral |
2000 UI
|
| Injection | Parenteral |
2000 iu
|
| Injection, powder, for solution | Parenteral |
5000 IU
|
| Powder, for solution | Intramuscular; Subcutaneous |
10000 unit / vial
|
| Injection, powder, for solution | — |
|
| Injection, powder, lyophilized, for solution | Parenteral |
5000 IU
|
| Powder | Not applicable |
1 g/1g
|
| Injection, powder, lyophilized, for solution | Intramuscular; Subcutaneous |
75 IU
|
| Injection, powder, lyophilized, for solution | Intramuscular; Subcutaneous |
7500000 IU
|
| Injection, powder, lyophilized, for solution; kit | Intramuscular |
10000 [USP'U]/1
|
| Injection, powder, lyophilized, for solution; kit | Intramuscular |
5000 [USP'U]/1
|
| Injection | Parenteral |
|
| Injection, powder, for solution | Intramuscular |
|
| Kit; powder, for solution | Intramuscular |
10000 unit / vial
|
| Injection, powder, lyophilized, for solution | Intramuscular; Subcutaneous |
1500 iu
|
| Injection, powder, for solution | Intramuscular |
5000 IU
|
| Injection, powder, for solution | Intramuscular; Subcutaneous |
5000 iu
|
| Injection, powder, lyophilized, for solution | Intramuscular; Subcutaneous |
5000 iu
|
| Powder | Parenteral |
5000 IE
|
| Injection, powder, for solution | — |
5000 IU
|
| Injection, powder, lyophilized, for solution | Intramuscular; Subcutaneous |
500000000 IU
|
| Injection, powder, for solution | Subcutaneous |
|
| Kit; liquid; powder, for solution | Intramuscular; Subcutaneous |
|
| Powder, for solution | Intramuscular |
10000 unit / vial
|
| Injection, powder, lyophilized, for solution | Intramuscular; Subcutaneous |
100000000 IU
|
| Injection | Parenteral |
10000 IU
|
| Injection | Parenteral |
5000 IU
|
| Injection | Parenteral |
7500 IU
|
| Powder | Parenteral |
5000 iu/1ampoule
|
| Powder | Parenteral |
10000 iu/1vial
|
| Powder | Parenteral |
2000 iu/1vial
|
| Powder | Parenteral |
5000 iu/1vial
|