PPIDT00299
Drug Information
| Name | Tetanus immune globulin, human |
|---|---|
| Sequence | EVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC |
| DrugBank_ID | DB11604 |
| Type | biotech |
| Indication | For use as prophylaxis against tetanus in patients who are injured and have incomplete of uncertain immunization status [FDA Label]. May also be used in the treatment of active tetanus. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Solution | Intramuscular |
250 IU
|
| Liquid | Intramuscular |
0.165
|
| Injection | Intramuscular |
250 [iU]/1mL
|
| Solution | Intramuscular |
250 unit / mL
|
| Solution | Intramuscular |
250 unit/1
|
| Solution | Intramuscular |
250 [iU] /mL
|
| Injection | Intramuscular |
250 units
|
| Injection, solution | Intramuscular; Parenteral |
250 IU/1ML
|
| Injection, solution | Intramuscular; Parenteral |
500 IU/2ML
|
| Injection | Intramuscular |
250 iu/ml
|
| Injection | Intramuscular |
500 iu/2ml
|
| Injection, solution | — |
|
| Injection, solution | Intramuscular |
250 IU/mL
|
| Injection | Intramuscular |
1500 IU/ML
|
| Injection | Intramuscular |
5000 IU/ML
|
| Injection, powder, for solution | — |
250 UI/2ML
|
| Injection, solution | Intramuscular |
|
| — | Intramuscular |
250 IU/2ml
|
| Injection, solution | Intramuscular; Parenteral |
250 U.I./2ML
|
| Injection, solution | Intramuscular; Parenteral |
500 U.I.
|
| Solution | Intramuscular |
25000000 IU
|
| Injection, solution | Intramuscular |
250 IU/2mL
|
| Powder, for solution | Intravenous |
|
| — | Intramuscular |
|
| Solution | Intramuscular |
250 iu/1ml
|
| Solution | Intramuscular |
125 iu/1ml
|