PPIDT00306
Drug Information
| Name | Sarilumab |
|---|---|
| Sequence | EVQLVESGGGLVQPGRSLRLSCAASRFTFDDYAMHWVRQAPGKGLEWVSGISWNSGRIGYADSVKGRFTISRDNAENSLFLQMNGLRAEDTALYYCAKGRDSFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| DrugBank_ID | DB11767 |
| Type | biotech |
| Indication | Sarilumab is indicated for the treatment of following conditions: - moderately to severely active rheumatoid arthritis in adults who have had an inadequate response or intolerance to one or more diseasemodifying antirheumatic drugs (DMARDs) [L45454] - polymyalgia rheumatica in adults who have had an inadequate response to corticosteroids or who cannot tolerate corticosteroid taper [L45454] - active polyarticular juvenile idiopathic arthritis (pJIA) in patients who weigh 63 kg or greater [L51349] |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Injection, solution | Parenteral; Subcutaneous |
150 MG
|
| Injection, solution | Parenteral; Subcutaneous |
200 MG
|
| Injection, solution | Subcutaneous |
150 mg/1.14mL
|
| Injection, solution | Subcutaneous |
200 mg/1.14mL
|
| Solution | Subcutaneous |
150 mg / 1.14 mL
|
| Solution | Subcutaneous |
200 mg / 1.14 mL
|
| Injection, solution | Subcutaneous |
150 mg
|
| Injection, solution | Subcutaneous |
200 mg
|
Target Information
| Role | Uniprot_ID | Gene_Name | Entity_Name | Organism | Actions | Internal link |
|---|---|---|---|---|---|---|
| target | P08887 | IL6R | Interleukin-6 receptor subunit alpha | Homo sapiens | antagonist|antibody | Link |
| target | P12314 | FCGR1A | High affinity immunoglobulin gamma Fc receptor I | Homo sapiens | unknown | Link |
| target | P12318 | FCGR2A | Low affinity immunoglobulin gamma Fc region receptor II-a | Homo sapiens | unknown | Link |
| target | P31994 | FCGR2B | Low affinity immunoglobulin gamma Fc region receptor II-b | Homo sapiens | unknown | Link |
| target | P08637 | FCGR3A | Low affinity immunoglobulin gamma Fc region receptor III-A | Homo sapiens | unknown | Link |
| target | O75015 | FCGR3B | Low affinity immunoglobulin gamma Fc region receptor III-B | Homo sapiens | unknown | Link |
| enzyme | P08684 | CYP3A4 | Cytochrome P450 3A4 | Homo sapiens | inhibitor|inducer | Link |