PPIDT00372
Drug Information
| Name | Lipegfilgrastim |
|---|---|
| Sequence | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| DrugBank_ID | DB13200 |
| Type | biotech |
| Indication | Indicated for the reduction in the duration of neutropenia and the incidence of febrile neutropenia in adult patients treated with cytotoxic chemotherapy for malignancy (with the exception of chronic myeloid leukaemia and myelodysplastic syndromes) [L2441]. |
Dosage Forms
| Form | Route | Strength |
|---|---|---|
| Solution | Subcutaneous |
6.000 mg
|
| Injection, solution | Intramuscular; Subcutaneous |
6 MG
|
| Injection, solution | Parenteral; Subcutaneous |
6 mg/0.6ml
|
| Injection, solution | Parenteral; Subcutaneous |
6 MG
|
| Injection, solution | Subcutaneous |
6 mg
|
| Injection, solution | Subcutaneous |
6 mg/0.6ml
|
| Injection, solution | Subcutaneous |
6.00 mg/0.6ml
|
| Injection, solution | — |
10 mg/ml
|