PPIRE00001
Target Protein Information
| Protein_Name | Serine protease 1 |
|---|---|
| Protein_Sequence | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN |
| Organism_Source | Bos taurus |
| Functional_Classification | Protease |
| Cellular_Localization | Extracellular |
| Gene_Names | PRSS1 |
| UniProt_ID | P00760 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 1-b(SS) |
|---|---|
| Peptide_Sequence | PCKARIfPYGGCR |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | C2<->C12; Side chain cyclization; Disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1467.77 |
|---|---|
| Aliphatic_Index | 37.69231 |
| Aromaticity | 0.15385 |
| Average_Rotatable_Bonds | 3.38462 |
| Charge_at_pH_7 | 2.87288 |
| Isoelectric_Point | 9.53993 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 559.79000 |
| X_logP_energy | -4.81826 |
Interaction Information
| Affinity | Ki(app)=2.2×10^-6 M |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A synthetic 13-residue peptide designed to resemble the primary binding site of the basic pancreatic trypsin inhibitor. |
| Release_Year | 1982 |
| PMID | 6173072 |
| DOI | 10.1016/0167-4838(82)90325-9 |