PPIRE00026
Target Protein Information
| Protein_Name | Substance-K receptor |
|---|---|
| Protein_Sequence | MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATKCVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLRHLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | TACR2 |
| UniProt_ID | P21452 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NRA-Oxidized |
|---|---|
| Peptide_Sequence | RKTDSFVGLX |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)O)C(C)C)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1079.22 |
|---|---|
| Aliphatic_Index | 68.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | 0.99813 |
| Isoelectric_Point | 9.69502 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 490.90000 |
| X_logP_energy | -5.79083 |
Interaction Information
| Affinity | IC50=5.4 nM |
|---|---|
| Affinity_Assay | Radioligand Binding Assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Agonist and antagonist binding to tachykinin peptide NK-2 receptors. |
| Release_Year | 1988 |
| PMID | 2838713 |
| DOI | 10.1016/0024-3205(88)90246-9 |